SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00000774g0010.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00000774g0010.1
Domain Number 1 Region: 532-796
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-72
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 1270-1429
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-40
Family Protein kinases, catalytic subunit 0.00088
Further Details:      
 
Domain Number 3 Region: 874-951,1028-1043
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-26
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 
Domain Number 4 Region: 143-273
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-26
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 
Weak hits

Sequence:  NbS00000774g0010.1
Domain Number - Region: 410-447
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0129
Family Hairpin loop containing domain 0.025
Further Details:      
 
Domain Number - Region: 1128-1170
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0169
Family Hairpin loop containing domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00000774g0010.1
Sequence length 1451
Comment protein AED:0.10 eAED:0.12 QI:0|0|0|1|0.16|0.28|7|0|1451
Sequence
MIYFASTVNKKVISQKGIKFAVGFVYKAMTAEWRLHFPVILFIYIILSSSQFAISKQSWN
FNVSLWNSTARVPTFWINKPFVNRNYSTTDFSAITPVLLSGKDSGSQFLCGFVCNYEATG
CLLGTLLAFYNSTASEKKYTILCPQLVWSANRNRPVKANATLQLGQDGNLVLLDSDGTLV
WSTNSTGKSVSGLNLTERGNLVLFDIRNRAIWQSFDNPTDSLLSGQDLVSGQKLIASISA
SNKSQGLLSLSILNGSLVAYTDTNPPQYYYASDYTNDTGLSFDGHTLRLASTFAQFMKLE
HNGHLRLYQFDIYELDWKVVSDVWTSESDVGNCGYPMVCGRYSICTSDGQCNCPYEGNFF
RPSIGRKTDLGCTALTPITCDSLQYHSLLELSDTRYFAFDVNFQLNSSIWFEGIKLEDCK
MACLRNCSCKAVVWDGTRRKNCLLLNEVFSIMDNGERRDKTTVFLKVQNQSPITSGGKQS
RPVKVILGSTLAALVGIILSITTWFILFKKRSQSSKVGDFLDIEPLRFQQKAQGGFGSVY
EGTLSNGTKIAVKHLDGVGQVKDSFLTEVNIVGGIHHVNLVKLIGFCAEKSDRLLIYEFM
VNGSLDRWISHEKQENRLTWKTRQSIISDIAKGLAYLHEDCSHKIIHLDIKPQNILLDQY
FNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLSSVITEKVDVYAFGIVLLEILCG
RKNLDWSQTDEEDVHLLSVFRRKLEQQQLKDMVDKNDEDMLLHKDAATEMMSIAAWCLQG
DFSRRPSMSLVVKVLEGLVTVETDLDYNFTNVPEVREGNQQREATISSRYPSVLSGPRSN
FLCGSDCNYNGSGCFLGVLLFPNRSNGEKGIINLPQLVWSANQNHPVKANATLQLGRDGN
LVLADFDGTLVWSTNTTGKSVSALNLTERGNFVLFDKRERAIWQSFDHPTDCLLPGKKLV
SGRKLTTTISSTNHSFSFTVLRGSLVTSIDTDPPQNYMALNQYDAPGSPYYYFDGRTFTV
VQDPYTSGTQFIKLGPDGHIRVYQWDAIGLQDPPTSTAQCIKLDPDGHLRVYQWAVIDWK
EVSDILMPDARNCGYPMLTSISCNSLQYHSLIELKETTYFAFETNIKPSSSIWFEGTKLE
DCKTACLSNCSCKAVVWSGTPRKNCLLLNEVFSFKDNWAGRDKTTVFLKVQNSLKPQYQS
PNVSRRKQSRPLKVIVASTLAAFVGIGLSICVVCSFQKKDAARQGRGSSGSSNNLTGNPN
SILFQRLEKDFSRKLGEGGFGSVYEGTLSNGTKIAVKHLDCVAQGKDSFLTEVKIVGGIH
HINLVKLIGFCAEKSHRLLICEHMKIIHLDIKPQNILLNQNFNAKISDFGLSKLIGKNKS
KVVTRMEELGVITEKVDVYAFGIVLLELLCGGKNLDWSQADEEAVHLVRVFRRKKEQEQL
MDMVDKNNEDM
Download sequence
Identical sequences NbS00000774g0010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]