SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00000774g0011.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00000774g0011.1
Domain Number 1 Region: 1251-1535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-77
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 423-696
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.83e-54
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 3 Region: 870-935
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.75e-17
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Domain Number 4 Region: 89-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000602
Family alpha-D-mannose-specific plant lectins 0.0079
Further Details:      
 
Weak hits

Sequence:  NbS00000774g0011.1
Domain Number - Region: 1126-1167
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0549
Family Anti-platelet protein 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00000774g0011.1
Sequence length 1578
Comment protein AED:0.19 eAED:0.19 QI:0|0.16|0|1|0.16|0.42|7|0|1578
Sequence
MASLLILSSQHLINGQPSQTFITNSSISWINRPSYVVNSTDGAKLTPILSREGNRTMFVC
GFLCDYNGTACVFGVLLFPSLVYPCMDNPTLIWSANRNDPVRVDSTLQLRQDGVFLMDSN
GTLIWKIKTFGKLVSGFNLTKMGNLVLFGKSNDTIWQFFDHPTDSLVPGQIMAPGQKLIS
SISATSWNEGLFTFDVQSVGLFAYIESNPRQSYFSMLITDESSKFLRLSDFLNLSVSKGM
IFTYSEGDARFMKFGGDGHLRVYYWEGSSWTEAADLLTHSMVTTGIQLCCSCPQTAADQT
NFLQQINYRQPNQGCVLVTPISCEDSKYHALMELKDTAYIPLNLQYGTKTELENCKRSCL
SNCSCKAAQFRFSGPDDTMGDCLLSNQVFSLVNNDGALTKTTLLSRRRKELEEAEEEFLD
HVPGMSTRFSFEELTVMTETFSKKLGEGGFGSVFEGTMSDGTKIEVKHLQGFGNVKKSFL
AEVAFTMSILVGFCAEKSHRLLVYEYMANVDFSRKAGTLSYMECQEKNISDVAKGLAYLH
EDCNKKIIPLDIKPQNILLHQNFNAKVSDFGLSKLLGKDESKIVATMRGTPGYLAPEWLN
SVITEKADVYSFGILILEIICGRKNLDRRQDEDDMHLLSLFKRKSNETQLLEMVDKNSED
MQLHREEAVEMMKIAAWCLQSDYTKRPSMSLAVKVLHGLVAAETDLDFSFPHPPMTRRVA
EDNQEREAIVGISLPVPSELSGPSIILIFMTGFVIVSTAMIVEQKLHIDVLLTYFLFCSS
QFAISQISWNLNASLLNSTAGLSTFWTNRPTFLVNSTTDFSRLAPLLLRRNASSRFLCGF
YCNYNATECFFGVLLFQKRSYGQNDVINFPQLVWSANRNHPVKTNATLQLRQDGNLVLAD
SDGTLVWSTNTTGKSVSGLNLTERGNLALFDHPTDSLLPGQSLVRGQKLIASVSASNWSQ
GLLSLTVLNGSWATYIDSDPPQFYYTSTYSYSPYISFDSRTFTALQYPTTPTTQFMKLGP
DGHLRVYQWDEPNWKEASDILMPEVRNCEYPMVCGRYSICTNNGQCTCPPEESLFRLSSE
RKPDLGCTELTSISCDSPQYHSLVELKNTAYFAFRSSHELNSSIFWPEGKKLEDCKRACL
SNCSCKAAAFQYDWGTDRRGSCLLLNEVFSLVDNEDGIDKRVFLKVQNSSKAQNQSPIIS
GGRKSRPYKVIIGSTLSALFGIILSITTCFVIFKSGHISPKAGDFLDLEPILPGMLTRFS
YNELKIITKDFSTKLGEGGFGSVYEGTLNNGTKIAVKHLDGLGQVKDTFLTEVNIVGGIH
HVNLVKLIGFCAEKSYRLLIYEYMVNGSLDRWISHENGLAWHTRQRIISDIAKGLAYLHD
ECSQKIIHLDIKPQNILLDQNFSAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLSS
VITEKVDVYAFGIVLLELLCGRKNLDRSQADEEDVHLVSVFRRKAEQEQLIDMVDKNEDM
QLHQEAVIEMMNIAAWCLQGDFTKRPSMTLVVKALEGLVSVETNLDYNFTNVPQVGAGNQ
QREATISSKLPSVLSGPR
Download sequence
Identical sequences NbS00000774g0011.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]