SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00002424g0002.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00002424g0002.1
Domain Number 1 Region: 503-700
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-61
Family Protein kinases, catalytic subunit 0.0003
Further Details:      
 
Domain Number 2 Region: 64-151,183-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-24
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  NbS00002424g0002.1
Domain Number - Region: 352-394
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00667
Family Hairpin loop containing domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00002424g0002.1
Sequence length 718
Comment protein AED:0.09 eAED:0.09 QI:66|0.85|0.87|1|0.71|0.62|8|562|718
Sequence
MKLSCKKIFRWHAVLVLCFRIANALLDTISINQSLIGSETLFSNNNIFILGFFSPENSKN
RYFGIMFNTQSQSVVWVANRDSPLQDSSGRITISEGGNPVILNALKKSIWSSNISTAARN
TTAQLSDTGNLVLKDSFSGRTLWESFSDLSDSFLQHMKLGSDKSTNTTNLLKSCRSPSDP
SDGSFSAGIQSATIPQIFIWKNGLPHWRSGPWNKQIFIGVPEMTSFYFSGFELVNDNMGS
VYFSYSYSDQGDGMLYLVLNSTGFLQQKELYARKNDWTVTWATPANECDFYGKCGPYGSC
DPNSSPICTCLHGFKPKSQQEWGKGNWTNGCIRKTALESERNNSNIEQGKQDWFLRLQSM
KIPDSAIWVSLDKEDCESGCLRNFSCIAYSYYIGIGCMHWEGILLDVQKFSMGRADLFVR
LSYTEQVIGHLLRSADQKKENKAVIWIVVPVGSITIAILGYISCKLLAKHRGKKSKSELL
SSKSLPKYYKLNVVGDDINQVKFEELPLYNFDMLANATDNFHLSSKLGPGGFGAVYKGKL
PEGQEIAVKRLSQSSGQGLEEFMNEVVVISKLQHRNLVRLLGCCIERGEKMLVYEFMPKR
SLDAYIFGSHLEAEDFLDWSKRAIIVEGIGRGLLYLHRDSRLRIIHRDLKASNILLDEYL
NPKISDFGMARIFAGNQDQANTSRVVGTYGYMAPEYAMEDDSQKNPMFTASEFYYWKS
Download sequence
Identical sequences NbS00002424g0002.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]