SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00002424g0008.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00002424g0008.1
Domain Number 1 Region: 474-750
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.58e-76
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 77-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.24e-26
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Domain Number 3 Region: 751-862
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000133
Family Protein kinases, catalytic subunit 0.0051
Further Details:      
 
Domain Number 4 Region: 360-424
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000139
Family Pan module (APPLE domain) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00002424g0008.1
Sequence length 896
Comment protein AED:0.12 eAED:0.12 QI:0|0.66|0.57|1|1|1|7|146|896
Sequence
MGFCQAWKILLISLLLYCIIQSYYCYASDTILQSQKLLVGNTLTSASQVFELGFFSPANS
SKRYMGIWFKNIPSHKVVWVANRENPLNVSDSAASLSISKNGNLVILDGVLNVIWSSNVF
VPTNNTVEVVLQDSGNLVLKDNISGQCFFESFDYPCDTFLPGMKIGFNRITGERWLLSSW
HKENDPSPGNFSIGISDQLPPQFFIWNKSTPYYRTGEWNGLKFTGLPYIDSAAYIVQFVF
QQDFQEGTAYFTFLPNTSFLTFVELQSTGSVQVVQWTDGAPAWEVYAKMVHPPCDIYNTC
GPSAICSKNKYPTCSCLRGFVPRSSDEWSRGNWTGGCVRRTKLLCQRKGINTSPGVGQKD
GFLKFSGLKLPDLAAIFRLDSASECERLCLNNCSCTAYAYVAGIRCMLWSGDLLDMQDYS
YSGEDLFLRLAYSELGQKRKGTISFRIGDSFNISKEYALESFWVGNLKKEDPIELPLIEF
ELIAAATNNFKVDNKLGEGGFGPVFKGKLKGGQEIAVKRLSNRTGQGIEEFKNEIVLISK
LQHRNLVRLLGCCIEGEELIIYEYMPNRSLDKFLFDTSQKELLDWPKRFNIIQGVARGLL
YLHRDSCLNVIHRDLKVSNILLDEEMNPKISDFGLARTFQKQQQLVHTHRVAGTYGYMSP
EYALRGVFSEKSDVFSFGVLLLEIISGKKNSSFHYVEENLNLLNYAWKLWSEQRGLDFMD
GTLINSFSPEEITRCLRVGLLCVQECPRLRGVFSEKSDVFSFGVLLLEIISGKKNSSFHY
VEENLNLLNYCIQLLQAWKLWSEERGLDFMDGTLINSFSPEEITRCLHVGLLCVQECPRD
RPTMAAIILMLNSEMKCSTPKQPTFKFETYLDLGSSAKDNDKCSVNEFSASLSQGR
Download sequence
Identical sequences NbS00002424g0008.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]