SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00004201g0001.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00004201g0001.1
Domain Number 1 Region: 502-788
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-79
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 102-179,206-230
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.62e-25
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  NbS00004201g0001.1
Domain Number - Region: 384-421
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0785
Family Pan module (APPLE domain) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00004201g0001.1
Sequence length 830
Comment protein AED:0.26 eAED:0.26 QI:0|-1|0|1|-1|1|1|0|830
Sequence
MALYKIFPFLFILCCSFHLISSQPWDYPTANLSTTWVNSVSASHSVAFTDGSTVRAILLR
GTFGPRYACGFYCNGNCESYIFAIFIVQTNSISLITMPSIGFPQVVWSANRNKRVKINST
LQLTAEGDLVLRDADGTLAWSTNSAGKSVAGLNLTDEGNLVLFDAKNATVWQSFDHPTDS
LVPGQKLVPGTKLTASVSTTNWTKDGLFSFSATNDGLVAFVESTPPQTYFERSIGGLNTS
GGSNYVMYLNGSLALLSNSSDSNNPQTLISIPPASSAQYMKLESDGHLKVYEWQSRWNEV
NDLLTGFNGECYYPMVCGRYGICSRGQCSCPKSSSNSTSYFRQIDDRQGNLGCAEVTRLT
CNALNNHRFLELQDVDYFTFTADIKNTDMNACKDACLRNCSCKAALFRSGLNSSTGDCYL
PSEIFSLANNEKDRTRYDSYAFIKVQVEAEPAATKEKKGVNGAVLGSVIGLAILGILIAI
AVFIIWKKRKVNEDEENYLDHVPGMPTRFSYDDLKAATDNFTNKLGQGGFGSVFEGCLED
GTMIAVKCLDGIGQVKKLFLAEVETIGSIHHVNLVQLIGFCAEKSHRLLVYEFMSNGSLE
KWIYHGKQELTLDWNCRRKIIQDIAKGLAYLHEECRQKILHLDIKPPNILLDEKHNAKLS
DFGLAKLIDRNQSQVMTMMRGTPGYLAPEWLNGAITEKVDVYSFGIVILEILSGRRHFEA
SESEEQRVMLNLFKKKAEEGQLVDLIDKHSEDMQLYKEEVIKTMQIAAWCLQHDYTKRPS
MSMVVKAMEGVLDVEKNLDYSFNPQTVNVIPNITFADSTPLLPSVLSGPR
Download sequence
Identical sequences NbS00004201g0001.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]