SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00005173g0006.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00005173g0006.1
Domain Number 1 Region: 546-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-71
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 73-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.09e-22
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Domain Number 3 Region: 347-401
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000353
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00005173g0006.1
Sequence length 867
Comment protein AED:0.06 eAED:0.06 QI:105|0.8|0.5|1|0.2|0.5|6|388|867
Sequence
MQMHHNFFVLLFVILLCIHQSLGIYMISVNHSIFGDQTIISSGENFELGFFKPGTSKKYY
LGIWYRNVIPQTVVWVANRERPLSATDMMSAELKVLDGNLVLTTESKSLLWSTNISFPSS
NSLVATLSDDGNLIFSDGLNSIPPLWQSFDHPTDTWLPNAKTKYDKRSNTTKQIISWKNS
EDPSPGIFSVEMDQRNRQFLLKWNRTEVYSATGPWSGRIFSLMPEMSLNSLRYNFSYVDN
ENESYFMYSVSNSHKIRLTLDVSGQIRHLIWVENLMEWQPFTTQPRQPCEVYASCGAFSI
CNKESASFCNCLTGFTPRSDAEWDLNDHSGGCVRRLSLQCVAGKTKGGFLRNSKVTLPEH
SQTVTASSAEECHSICLNDCSCNAYAYDTSVCSIWNVELLNLRKLSPEDGGGSVIYTRLN
ALDQALGEVSKSGQLSVKLKVIISVVVVLAVVALCSFSYTYYRRKMAKRKGTCVVVFSGL
IVLPLATGKFSPSVFLFCLNQIKRDISNSCFLILANQQSTEGNPVPHWTEREAQNFIYEN
DKQDIAVPFFCLEKILAATDNFSDVHKLGQGGFGPVYKGIFSGGQEIAVKRLSSQSRQGI
DEFRNEVILISKLQHRNLVRLLGYCITGYEQILLYEYMPNKSLDTFIFDQTLSKSLKWKK
RFEIISGISRGLLYLHEDSRLKIIHRDLKTSNILLDQEMNPKISDFGLARIFEEKTTEAN
TKKVGLFSIKSDVFSLGVVILEIVTGRRNTGFYQSKEASNLLGYAWNFWKEERALHLLDH
LLLESCNPKEAMKCINVGLLCVQEDPGDRPTMSNVVMMLRSESMPIPKPNQPAFVSRKYV
SNASPALSAKYHSSSKVELTITMEEGR
Download sequence
Identical sequences NbS00005173g0006.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]