SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00006216g0013.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00006216g0013.1
Domain Number 1 Region: 7-49
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000504
Family alpha-D-mannose-specific plant lectins 0.02
Further Details:      
 
Domain Number 2 Region: 9-20,79-109
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000631
Family alpha-D-mannose-specific plant lectins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00006216g0013.1
Sequence length 249
Comment protein AED:0.18 eAED:0.19 QI:0|0|0|0.66|0.5|0.33|3|0|249
Sequence
HVSNSSTPLTLWQSFDNPTDTLLAGAKIGYKKITQKKQALISWKDFNNPAPGLFSMKLDQ
SNAQLALISWKDFDNPTPGLFSMELDQSNAQLVLKCNRTSEYWATGSWNGHRFSSVPDKL
NSVYNYSYIDNENESYFTYSHHTSSIITSRFVMDVSGQIKQLTWLNNSAGWNEFWARPRS
FSYIYYRRRMAKGADRRKGNQGVQISHWHKVKGEVKALRNENNQVIDVPYFHLETILAAT
NNFSDELGD
Download sequence
Identical sequences NbS00006216g0013.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]