SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00006986g0002.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00006986g0002.1
Domain Number 1 Region: 71-151,183-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-27
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00006986g0002.1
Sequence length 388
Comment protein AED:0.07 eAED:0.10 QI:66|1|0.85|1|0.66|0.57|7|1665|388
Sequence
MKLSCKKIFLWHAVLVLFFHIANALSDTININQSLSGSETLVSNNNIFILGFFSPENSTN
RYVGIMFNTQSQSVVWVANRDIPLQDSSGRITISEGGNLVILNAQKKSIWSSNIESTVRH
TTAQLLDTGNLVLKDSSSGRILWESFSDLSDSFLQYMKLGSDKSTNTANLMKSWRSPLDP
SDGSFSAGIQPETIPQIFIWKNGLPHWRSGPWNKQIFIGVPEMTSLYFSGFELVNDNMGS
AYFSYTYSDQGDGMLCLVLNSTGFLQQKELYDRKNDWTVTWATPANECDFYGKCGPYGRC
DPNSSPICTCLQGFKPKSQEEWGKGNWTNGCIRKTALEKERNNSNLEQGKQDWFLKLQSM
KVPDSAIWVSLDEEDCGQWMHQKDCIRE
Download sequence
Identical sequences NbS00006986g0002.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]