SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00007694g0013.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00007694g0013.1
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000433
Family Protein kinases, catalytic subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00007694g0013.1
Sequence length 184
Comment protein AED:0.41 eAED:0.60 QI:0|0|0|1|0|0|3|0|184
Sequence
MLKDGQEIAAKRLSRYSAQGTDEFTNGVIFKAKLQHQNLVKLLGCCIQAEEKMLIYEYMP
NKSLDLQGFGTNKCTSKGVKQPVSSATIIPCRSIVRAAMSRRYLACHKSEFHLQPVSSAK
IIPCRTIHCPEDRPTMASLLLMLSSDIPLPLPKEPGFFTKAYSSSSTQGESSVNDISITM
LDAR
Download sequence
Identical sequences NbS00007694g0013.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]