SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00008811g0004.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00008811g0004.1
Domain Number 1 Region: 69-265
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.03e-63
Family Penicillin synthase-like 0.0000000223
Further Details:      
 
Weak hits

Sequence:  NbS00008811g0004.1
Domain Number - Region: 38-71
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000236
Family alpha-D-mannose-specific plant lectins 0.02
Further Details:      
 
Domain Number - Region: 268-317
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00115
Family Penicillin synthase-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00008811g0004.1
Sequence length 332
Comment protein AED:0.22 eAED:0.22 QI:0|0.25|0.2|0.8|1|1|5|127|332
Sequence
MNLNGENFFHANSESSKSDYKESPTSLKASRTLTKAIPLPTPTVVWVANRDKPLRDSNGL
LTISEDVNLLVNHGIPHEVMDTVEKMTKGHYKKCMEQRFKESVASKGLEAVQAEIEKLAE
ELLDLLCENLGLEKGYLKNVFYGTKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGIILL
FQDDKVSGLQLLKDGQWIDVPPMRHSIVVNLGDLLEVITNGKYKSVMHRVITQTDGTRMS
LASFYNPGSDVLIFPAPTLVEKEAEERGDAVIFPAPALVEKDAEESKAVYPKFVFDDYMK
LYAGLKFQAKEPRFEAMIKAMETVNNDPVATA
Download sequence
Identical sequences NbS00008811g0004.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]