SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00008988g0011.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00008988g0011.1
Domain Number 1 Region: 268-400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.54e-31
Family Protein kinases, catalytic subunit 0.00087
Further Details:      
 
Domain Number 2 Region: 42-133
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000366
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00008988g0011.1
Sequence length 402
Comment protein AED:0.13 eAED:0.23 QI:0|0|0|1|0|0|3|0|402
Sequence
FSCYGFFPFLSSIDFAFGFQKLPTKDQFLLCIWCAKIQENPILWDANISNPVPRGSRLQL
DSQSGLILSDTQGSTIWRTDSVIGNIDRGFMNETGNFVIMGNDSTDSLWESFRNTIDTLL
PNQILERGSFLVSQISLANFSQEWNDVCVEEKQSKAISYSAIHSFNFGKLSSRATSITSI
EFSLIIIIPRSSNSSGWNILWSQPDNICVNINGDKGTGACGYNNVCSLGTNNRQLCVGEC
SFVGVLCWGSFNIYKNKSKTLRPTSHAVDSICHSFTYRELVEATADFKEELGRGAFGIVY
EGVMPIRSRNVVATKKLDRVVQEAEKKKEFMAEVNVISLTHHKNLVRLLGYFDEGSHRLL
VYEYMRNSTLANFIFGDPKPTWSQRTKVAMGIARGLAYLHEE
Download sequence
Identical sequences NbS00008988g0011.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]