SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00011263g0008.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00011263g0008.1
Domain Number 1 Region: 513-780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.52e-52
Family Protein kinases, catalytic subunit 0.00056
Further Details:      
 
Domain Number 2 Region: 77-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.67e-22
Family alpha-D-mannose-specific plant lectins 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00011263g0008.1
Sequence length 798
Comment protein AED:0.17 eAED:0.17 QI:19|0.33|0.28|1|0.16|0.42|7|93|798
Sequence
MITCNQNLQYLLINILVLYAFYFGLCIGICNITSTQYLRDPATLWCPGNIFKLGFFSPQN
SSYRYVGIWYNFSETTVVWVANRDKPLKDSSGVVKISEDGNVVVMNGDKQTLWSSNISSA
IHTTNSTAQLQGGNLVSLDNSNGSIIWQNYQHPSDTFLPKMKIPINSSKKKKKTGLRSWK
SPLDPSFGDFSSSITTILPQLFIWKGKYPHWRSGQWNGQIFIGVKNMRSVHTGGYNVVDD
EEGTVYLTGLADRKEAVRFTLEPNGNLVQSNWDENERNWKIPWLAITDDCDVYGTCGPFG
SCNSLDSPICSCLRGFDPKSREEWEKGNWSSGCVRRKPLECEEKNKTSKKDGFVKMEFVK
VPDFAEWLPPKMEDECRIQCLRNFSCLAYAFDAGIDCMSWCRSLIDIQEFKRAGTTLYIR
VAYSELGIFTFTVFVADHPRVIRLVAVLLIVSFLIVCVGMFLCWFWISRRRGKIWFQFKR
NHQLHGKKISLEEEITIKVDLDDLSMFKFEVLAMSTDQFMRIISLDEGILADGKEIAVKR
LSTASGQGMEEFMNEVLVISKVQHRNLVKLLGCCIKGGEDVDPTHKRILDLSKRLHIIEG
IGRGLLYLHRDSRIKIIHIDLKPNNDFNPKISDFGMARIFKCNQDQAETRKAAGTYGYMA
PEYSIKGTFSEKSDVFSFGVLLLEIMCGQKVTSFWNEDIPLSFLGYAWELWKENNISNFI
DPVIWDPEFEVVLKRCIHIGLLCVQEFARDRPTISTVLSMLSSEVTSLPAPLQPAFANFF
EDNGGSVNYVTLTNLDGR
Download sequence
Identical sequences NbS00011263g0008.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]