SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00011924g0005.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00011924g0005.1
Domain Number 1 Region: 82-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.29e-17
Family alpha-D-mannose-specific plant lectins 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00011924g0005.1
Sequence length 463
Comment protein AED:0.03 eAED:0.03 QI:0|0.5|0.33|1|0|0.33|3|0|463
Sequence
MKIYVLVFFIYLLAHGYCTSNVHIGYQVSLAIPTTYSKGFIGRAFLMETDNQMTPNFRAA
ISVEAINEKYTCSLDVFLGDVKVWSSGHLSQFYTIDKCALQLTQYGDLQLKGQDDKVGWK
AGTSGQGVKRLHLLGSGNLVLVDALNLIKWQSFNFPTNIMLWGQRLSSRTRLTSFPSNSS
LSYSFEIQYDKIALYLYSGKSKYSYWEYTPFELNDLNITYVELTSNALEIFNNETIELDP
EPVRFLALGNNTGNMGFYYYSAEKGKFEASYQALNATCDLPLACRPYGICTFSEECSCIR
LIKRGDGLLSDCAENVTEGLCGRTESQMLELQGVTSVLRSNPYKVNVSKEVCANLCLDNC
TCVAALHFSVDDSEDDSTKSGECYSYGLVRGVKQIERDGRLSYMVKVPKGTDQDHGEHCH
WKKWIPIVVGVVDGVIVLLVLGGIGYYVIRKRRKSCVDTGPNN
Download sequence
Identical sequences NbS00011924g0005.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]