SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00012311g0019.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00012311g0019.1
Domain Number 1 Region: 515-785
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-69
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 80-165
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.07e-21
Family alpha-D-mannose-specific plant lectins 0.0022
Further Details:      
 
Weak hits

Sequence:  NbS00012311g0019.1
Domain Number - Region: 211-318
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.00798
Family Fucose-specific lectin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00012311g0019.1
Sequence length 874
Comment protein AED:0.07 eAED:0.08 QI:0|0.8|0.66|1|0.8|0.66|6|0|874
Sequence
MAPNLLSSALALILLLFIAELCCCVESSGVALGSRLLAKENKAWFSDNKTFAFGFTPTAE
SHDKYQLSIWCAQLPGDRTLVWSPSINSPVTRDAILEFDNTGNLMLMDRGTTVWASNTSE
AGVETAVMSENGNFILYADNLSIVWQSFSHPSDTLLPGQPLTVSLELTSSKSPAPGGYYT
LKMLQQPTSLNLALTYNVPESYHMSPELYSNYSYWSGPDISNVTGDVVAVLDKAGSFGMV
YGSSSDGAVYVYKNDDDYGGLFSAVNQSNWSTPSVFRRLILEGNGNLRLYRWDNDVNGSR
QWVAEWAAVSNPCGIAGICGNGICNLDRSKTNASCTCLPGTSKVGHDISCSVNSSLTGKC
GPHHENLTSQFKISTVQQTAYYFSGSSVIANYSDIQSVSKCGNACLSNCECVASVYGLSE
EKTYCWVLRSLEFGGFEDPGSTLFVKVEANASFGVSDDKQTGNSSEESQITRDKVLILPI
VLSMTVLIALLGCLLYINIHRKRSLKRALEGSLILRGAPISFSYRDLQYRTNNFSELLGT
GGFGSVYKGSLGDGTLIAVKKLGKVLPHGEQEFITEVNTIGSMHHMNLVHLCGYCSEGTR
RLLVYEFMKNGSLDKWIFHSYSNRDRLLDRLLIWPTRFRIAIATAQGIAYFHEQCRNRII
HCDIKPENILLDENFCPKVSDFGLAKLMGREHSHVVTMVRGTRGYLAPEWVSNRPITVKA
DVYSYGMLLLEIEMSKGTPEKVVDKRLEGAIEKEEVMRALMAAFWCIQDEVSTRPTMGEV
VKMLEGSVDINMPPMPQTDEVSTRPTKGEVVKMLEGSVDINIPPMPQTVLELIEEGLDHV
YRSMKRELNQFSSFTITTHPSSNATCSYSTMSPR
Download sequence
Identical sequences NbS00012311g0019.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]