SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00012738g0005.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00012738g0005.1
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000144
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Domain Number 2 Region: 340-395
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000019
Family Protein kinases, catalytic subunit 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00012738g0005.1
Sequence length 408
Comment protein AED:0.29 eAED:0.31 QI:0|-1|0|1|-1|1|1|0|408
Sequence
MTETGNLVLHDMYNETVWQSFDHPTDTLLPGQKLWAGQRLVARVSSSNWTEGNYFLSVTN
QGLFAFYISNKPHMYFKFLVTGERDSFNESYVKAVNGTLALYISSTEPSEPNAVFSRPSR
MNFLRYDYDGHLRSYAEGSDQQTDLLADFIGVCDYPTACGSLELCSNGFCSCSGPFKRSN
DRQNSGCVEVSPVECNGQRSHKMIPVSDVYYFNYVDTAAAALRGTYVESCQELCMRNCSC
KVVLFRYFTNVSSGDCFLPSPVLTLINDEKERSGYESSAFIKIPNDTEKDTDSIAARRIG
IIAGSISGAFLLIAICVSILIAIKRKQTLQEDNDDYSDEISGTLRFSYEQLKVATGNFQQ
KLGQGGFGSVYEGVLQDGQKVAVKVLDGFGQGKREFGRGPNHRKHPSC
Download sequence
Identical sequences NbS00012738g0005.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]