SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00012905g0012.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00012905g0012.1
Domain Number 1 Region: 357-614
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.46e-46
Family Protein kinases, catalytic subunit 0.0028
Further Details:      
 
Domain Number 2 Region: 71-182
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-23
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 
Weak hits

Sequence:  NbS00012905g0012.1
Domain Number - Region: 268-324
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00569
Family Anti-platelet protein 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00012905g0012.1
Sequence length 629
Comment protein AED:0.23 eAED:0.23 QI:0|0.5|0.42|1|1|1|7|197|629
Sequence
MNGLPLFVCSQLLFILLTSAALDTITRDKPIRDGDTIVSAGGVYELGFFSPGNSKNRYVG
IYYKKISPTTVVWVANRNIPLNDTSGILTLKPNGTLVVHVNSSKASIWSSNSTRSLKNPK
ARLLDSGNLIVSGRNERGVEIDLVWQSFDYPGNTLLPGMKLGRNLVTGMNWYRSSWKSAD
DPAPGEYVDFLDSHGYPQLFVVKNSSIVYSAGPWNGVAFSGSPNSKPNMYYTFEFIINQQ
EIYYKYEIKNASLPTSGCVRRTSLACDQDDFLKLTGIKMPDSRHSWYNQSMNLEECKKMC
LADCNCTAYSNLDVRNGGSGCLLWFGELIDIRELSHNDQNLFVRVAASELGLEVSNEDME
LPLFDLVAVTSATKNFSSANVIGEGGFGPVYKGILPNGQEIAVKRLSKYSEQGVQELKNE
IVLISKLQHRNLVKLLGCCLEGEERMLIYEFMPNTSLDYFIFDPSRNASLPWKNRFEIAM
GISREYAVDGKYSVKSDVFSIGVIILEIVCGRRNRRFRHLEHHHNLLGHAWLLWNEGKAL
ELMDKCLEESFSESQVLRCIQVGLLCVQKLPEDRPTMASVVFWLENEGLVLPQPKQPGFF
IERNSMESSESADEGCLSNNVSLTVLEPR
Download sequence
Identical sequences NbS00012905g0012.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]