SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00014745g0001.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00014745g0001.1
Domain Number 1 Region: 477-761
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.73e-79
Family Protein kinases, catalytic subunit 0.0000964
Further Details:      
 
Domain Number 2 Region: 68-202
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.02e-20
Family alpha-D-mannose-specific plant lectins 0.0063
Further Details:      
 
Domain Number 3 Region: 171-272
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000183
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  NbS00014745g0001.1
Domain Number - Region: 276-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00222
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 347-380
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0341
Family Hairpin loop containing domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00014745g0001.1
Sequence length 791
Comment protein AED:0.07 eAED:0.07 QI:0|-1|0|1|-1|1|1|0|791
Sequence
MAVLLWLFFLSAFHVVALAQQPNFNITPGSSLTPTSNSSWFSPSKHFAFGFYEQTNGYAV
GISIISMPKKTAVWTANRDSPAVPSSAVLLLTTDGRLIVQVGQGQEIPVINPSQAIASAS
MLDTGNFVLYNSNHNIIWQSFDNPTNAILPGQHLSAEQELFSSASEEDDSLGIFRLKMQS
DGNLVQYPVQTPDTDSYSYFSTRTSGVGNNVTLNLGDDSLLYLTNSTRSLKNLTKGGNPR
ERTIYLMKIDVDGILRVYSHSLSQQNSSAIWSSTDNKCDPKGLCGLNGFCINIDDQVNCT
CLPGFDFVKPGNWSAGCERNFTAETCWLKEKASKYYAMRSVENTRWEDTSYATLVTTTKE
DCVQACLQDCNCEAALFKDRECRKQRLPLRYGRRYMSDSNLASVLVKVGINVFAEEELFN
QTEETKGEKLRMGILIAGITLAAFAFLVLGISGFLVHRNHMWTYRKIQESRSVHLCEDVG
PRAFSYAELEQATSGFTEELGRGAFGTVFKGILAEDQKAVAVKRLDKELVEGEKEFQTEM
KIIGRTHHRNLVRLLGYCLDGSRRLLVYEYMSNGSLSDILFTPEKQSTWEERCGIARDIA
RGLLYLHDECDTQIIHCDIKPQNILMDDHFCAKISDFGMAKLLKKDQTRTYTGVRGTRGY
VAPEWHRKLPVTVKADVYSFGIVLLELICRRKCVDWSLAEDESILEYWVYSCYEAGELGK
LVGDEEVERRQFERMVKISIWCIQDEPSLRPSMKKVLLMLEGTVDIPVPPSPTSFHHLYF
SYIQNNSIKFS
Download sequence
Identical sequences NbS00014745g0001.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]