SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00016727g0016.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00016727g0016.1
Domain Number 1 Region: 488-686
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-55
Family Protein kinases, catalytic subunit 0.00031
Further Details:      
 
Domain Number 2 Region: 69-174
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-28
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Weak hits

Sequence:  NbS00016727g0016.1
Domain Number - Region: 338-378
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0942
Family Anti-platelet protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00016727g0016.1
Sequence length 729
Comment protein AED:0.15 eAED:0.15 QI:0|0.66|0.42|1|0.66|0.57|7|0|729
Sequence
MEAINIHFLLFFILILYGAADTIPVDQPLTDGNTIISSGGKFELGFFSPGTSRKRYVGIW
FSKVSVQTVVWVANGDSPLDDRNGMLNFTRQGMLVLLNGSGHVIWSSNATRHAQNSTAQL
LDSGNLVVRDATVNYLWQSFDYPTDTSLPGMKVGIDLKTGFRRSLWSWKSTNDPSRGEFT
WTFDPHGFPQPFIMNGSIERHRFGPWNGLGFASASSRLPGPGYKYTYVSNPEQISIMYEL
IDSSIFARVVMQLDGVLQLSLWNNQTQNWDNYFGSAPADDCDIYSRCHGYSLCNNGNSSI
CSCLDQFEPKNPTEWARENWSSGCVRKTTLNCQKKVKFLKYPGIKLPDTRFSRYNHGVNL
STCEELCLRNCSCVAYANPDITGTNEGCLLWFDELIDIRDLGASGQDIYIKLDSSQSENS
SLEKVKKLRISLPLAISILLLALCLILYIKQKKKEKKDQDQIHFGEGKGRKISEMFYTNE
SKDEVPDVPLFDFATILDATDNFSLNNKLGEGGFGPVYKGMLKEGPEIAVKRLSRYSAQG
TDEFMNEVIFIAKLQHRNLVKLLGCSHLAFMNYLVKKQNHKLSISADRDRSLLLDWPKCF
HIINGIVRGLLYLHQDSRLRIIHRDLKPSNVLLDIDMNPKISDFGTARSFGGNETGARTT
RVVGTYGYMSPEYAAEGKFSVKSDAWILFNEGRVLELINAHLRESSNLSQVQRSFHVGLL
CVQQCPDDT
Download sequence
Identical sequences NbS00016727g0016.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]