SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00016909g0018.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00016909g0018.1
Domain Number 1 Region: 76-161
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-27
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Domain Number 2 Region: 435-512
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000214
Family Protein kinases, catalytic subunit 0.0035
Further Details:      
 
Weak hits

Sequence:  NbS00016909g0018.1
Domain Number - Region: 288-344
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0019
Family Anti-platelet protein 0.062
Further Details:      
 
Domain Number - Region: 513-591
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00479
Family Protein kinases, catalytic subunit 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00016909g0018.1
Sequence length 613
Comment protein AED:0.18 eAED:0.18 QI:0|0.6|0.33|1|0.8|0.66|6|0|613
Sequence
MANGLINFHWFLVLFIVCYFSLLCSASNKVRQGEILRDGNNIISPKGKFNLGFFSPKHSN
QRYLGIWYADVPVLSVVWVANREKPVCDQNGVFTIEKNGNLVVKDGRGDLLWSTNVSVVE
TINSTVSLLDTGNLVILNDNNKVLWQSFQHSTDTFLPEMRALYFNGFKLYNEGNRLYFTY
TAANTSNLVRFHISPSGYEQQQMWDMDKRKWSMIQSHPLGYCDIYNSCGNFAKCDISNSR
KCTCLYGFVPKDWEQWNARNWSGGCVRRTRLECGRNSSVLRNDIGNGDGFLEIKGIKLPD
FADTATAENVDECKSTCLENCSCTAYAFVIGIYCMIWSGDLVDLQQFNEGRNTLYVRLAH
SEFGKKNRTIKIVLISILVAVAFVICMAIWLLCKYKAKRRGSIRINEMPIRDPIRSGELP
MDLSGPGDLSVEGHQGSSSELKFFSFSSIVAATRNFSNENKLGQGGFGPVYKGKLQCGEE
IAVKRLSRKSGQGVEEFKNEIMLIAKLQHRNLAWEKWDEGRPTDLVDRSIWDECQHNEVL
RCIHLALLCVQDMAVHRPNMSSVVLMLETDNIRLPLPRQPTYTSMRKHENADIWNEKQEF
SSNDVTMSVIVGR
Download sequence
Identical sequences NbS00016909g0018.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]