SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00017129g0016.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00017129g0016.1
Domain Number 1 Region: 4-37
Classification Level Classification E-value
Superfamily F-box domain 0.0000249
Family F-box domain 0.0086
Further Details:      
 
Weak hits

Sequence:  NbS00017129g0016.1
Domain Number - Region: 172-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0054
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Domain Number - Region: 194-253,304-392
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0322
Family Quinohemoprotein amine dehydrogenase B chain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00017129g0016.1
Sequence length 411
Comment protein AED:0.17 eAED:0.17 QI:0|1|0.5|1|1|1|2|388|411
Sequence
MAEWCQLPRELVHLISKHLSSEIDFLRFRSVCSSWRSSVPPKPYPNSPSRFPILPNNGIA
ENSWGFKLTKTPLYLVSPPAETTSSDGNHGGWILKLDRENPQRMRLLNPLSRSQFKPLPS
NFPKKLDSSQYPILELGQEYTLQFIKYRPRANSIADAGNLYMEKVAVRLEEDGFLLLTIH
VSGKLVMYRSGDTKWSIVDDSSLPYDDVILKDGNFYAVDNTGKGVLVKLSDGSAPELTIV
GQSVFGGDKKFLVESCGELLMVDKYLSIGPEDDLGYNENVEFYEEFDCYMSERTVKFKVY
KLDGDMQRWVEVTDLDDRILFVGDNCTFSALVSEVDCGCKGNCILFTDQFFCSTEDDGGL
WKNYGIGVFNLDNGSIGPISSYNGYAELFWPPPSWICSPRPIDSELNELKI
Download sequence
Identical sequences NbS00017129g0016.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]