SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00019884g0016.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00019884g0016.1
Domain Number 1 Region: 457-755
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-72
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 75-165
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-24
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  NbS00019884g0016.1
Domain Number - Region: 318-354
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Pan module (APPLE domain) 0.095
Further Details:      
 
Domain Number - Region: 156-239
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0176
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00019884g0016.1
Sequence length 769
Comment protein AED:0.04 eAED:0.04 QI:0|0|0.33|1|1|1|3|206|769
Sequence
MDVPILILVLASLVALPVSSSSTIFYLSEGSLSAPQNSLLSPNGEFTAGFYSVGDNAYFL
AIWFTKPLANGNNTVVWIANSDQPINGRKSHLSLLKSGNLVLIDAGQTTVWESGTKSSSS
VELRLLDNGNLVLVTSEGLEIWQSFDSPTDTLLPEQPLTKTSKLVHFNEDNVLHLVFDGI
EMTSRSTYNDSKTAVLDRLGNFVSSDEFRFQSSDYGVELRRRLTLDVDGNIRLYSLDMLS
NTWRVTWQLFIAACRVHGVCGLNSLCSYDPYFGRKCSCIPGYRMRNPTDWSYGCEPEFEI
SCNDTSSMGFFPLHHVEFYGYDIAYLPNKTLQECKNLCLKRCDCKGFQYKFVEGNNTYGC
YPKTLLFNGYVQSSWPDIVYVKLPKGRQTWQTNYKGNLQCGNEKVMLDRAYKRKEQHGWI
KSFIWSIVVAGVLEILCFLTYWIKTRKGSHETKQGYLQLSTRFKKFTYAELKKASSNFSE
EIGRGGGSIVYKGKLSDDRVAAIKSLSGGANNQGEAEFLAEVSTIGNLNHMNLIELWGYC
AEGMHRLLVYEYMEYGSLSDNLHANKLDWEKRFEIAVGTAKGLAYLHEECLEWVLHCDVK
PQNILLDSNYKPKVADFGLSKILNRGGLDNSSISTIRGTRGYMAPEWVFKMPITSKVDVY
SYGIVLLEMITGKSPEVCVHGDSKDNDAMGQGVLVTWIREKMREASETKSWIQEIVDPSL
NGEFDLEKMEILLKVALQCSKEDRDARPTMCEVVDKMLHPENLELKIDI
Download sequence
Identical sequences NbS00019884g0016.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]