SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00020157g0001.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00020157g0001.1
Domain Number 1 Region: 472-726
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.27e-36
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 85-205
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-20
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  NbS00020157g0001.1
Domain Number - Region: 332-385
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000216
Family Anti-platelet protein 0.054
Further Details:      
 
Domain Number - Region: 175-271
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00245
Family alpha-D-mannose-specific plant lectins 0.0075
Further Details:      
 
Domain Number - Region: 278-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00020157g0001.1
Sequence length 758
Comment protein AED:0.15 eAED:0.15 QI:339|1|0.66|1|0|0|3|0|758
Sequence
MVRGDRIACYSNLLLSVSIGFLLFSGVSSQIPLGSKLTVEENNYWVSSNGDYAVGFLNSS
DQYIFGVRFNSIYIPSTKQTALWTVGNVKVSSKAYFKLSHGGEMILFDPAVERIVWQSET
GNASVGSAVLLDNGNFVLLNRNKNAVWQSFDSPFDTLLPGQSLSVGHTLRASSRDSLASY
YSLVMNVSGEMQLRWDSTVIYWTVGGPSQPAVRSILGSDGILRLIDQRSKVVSSVYGEDH
SDPDVKFRFLRLDSDGNLRMYSWKTNAMSWTTVWQAVINQCDVFATCANQGICIFNASDS
YVCQCPFRSTRDSNTKCLIPYKPSCESGSSMIRYDHMYLYGIYPPNKTVVITSLQQCRSL
CQKDPSCHASSFINNGTAQCHMMKSQYIGGQSDPSLGSITFVKTCSDPIAVLPAPVPAPR
KVSQKICVACLLEVAAGSVVVFFMLQFGIGVYLFRRRKSMVQKSALAHAVPNATSCVVFS
YSEIKDLTDNFKQQIGQNVFEGVLPDNRLVAVKVLNSSIEERRFRSAVLKIGSIYHKNLL
RLDGYCCESGRRLLVYELAKYGSIDKCLEEPRMCKRLTWRKRIDICFSVARAISYLHTGC
REFVSHGNLKCENVFLNEELEAKVSEFGLRTIQAEASSSGGLAETDVRDFGKMMVVLITG
RQDADEACYWAYEKWVKAEREMAIDQRIEGGVDLEELERAFRIAFWCLQGDEHMRPSMGE
VVKVLEGTLSVDPPPPPFAHNQQRPPEDESPSESYSEL
Download sequence
Identical sequences NbS00020157g0001.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]