SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00021081g0014.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00021081g0014.1
Domain Number 1 Region: 4-37
Classification Level Classification E-value
Superfamily F-box domain 0.0000314
Family F-box domain 0.0086
Further Details:      
 
Weak hits

Sequence:  NbS00021081g0014.1
Domain Number - Region: 237-320,348-439
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0209
Family Tricorn protease N-terminal domain 0.028
Further Details:      
 
Domain Number - Region: 228-278
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0316
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00021081g0014.1
Sequence length 466
Comment protein AED:0.09 eAED:0.13 QI:0|0.66|0.25|1|0|0.25|4|529|466
Sequence
MAEWCQLPRELVHLISKHLSSEIDFLRFRSVCSSWRSSVPPKPYPNSPSRFPILPNNGIA
ENSWGFKLTKTPLYLITPPAQTASSDNNHGGWIIKMDRENLRIPLLVSPFFLITASLKTV
GVLNLPKHPSTFPPAETTSSDGNHGGWILKLDRENPQRMRLLNPLSRSQFKPLPSNFPKN
LDSSQYPILELGQEYTLQFIRYRPRANSIADAGNLYMEKVAVRLEEDGILLLTIHVSGKL
VMYRSGDTKWSIVDDSSLPYDDVILKDGNFYAVDNTGKGVLVKLSDGSAPELTIVGQSVF
GGDKKFLVESCGELLMVDKYLSIGPEDDLGYNENVEFYEEFDCYMSERTVKFKVYKLDGD
MQRWVEVTDLEDKILFVGDNCTFSALVSEVDCGCKGNCILFTDQFFYSTEDDGGLWKNHG
IGVFNLDNGSIGPISSYNGYAELFWPPPSWICSPQSVDVELNELKI
Download sequence
Identical sequences NbS00021081g0014.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]