SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00024295g0007.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00024295g0007.1
Domain Number 1 Region: 1253-1535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-75
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 494-739
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-61
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 3 Region: 72-199
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.28e-20
Family alpha-D-mannose-specific plant lectins 0.0064
Further Details:      
 
Domain Number 4 Region: 848-978
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000537
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Domain Number 5 Region: 945-1037
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000123
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Weak hits

Sequence:  NbS00024295g0007.1
Domain Number - Region: 1056-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00024295g0007.1
Sequence length 1550
Comment protein AED:0.04 eAED:0.04 QI:0|0|0|1|0|0|2|0|1550
Sequence
MATFMFLMLMLFAAVEVGAQKQPSNITLGSILYPYRNPSSWLSSSGHFALGFYSKGDGFQ
VGIWLASTSQKTVVWTAGRDDPPVHSDGYLEFTKEGKLILWSKQNKKVIAESPEPVTSAS
MLDSGNFVLYNKIDIVWESFDYPTDTLLVSQRLISGHSLVSSVSETDHSIGRFYLSMQAD
GNLVAYPTNYINRPEASYWAFMLQSRGEFGDVDSVFVSLTSRGQLFRNASNGFGFQVNEI
ANSSTRTTNKTVIYRATLDPDGIFRLYTHSFEGRDESSLEINWSSLQNQCQARGFCGVNS
YCTARNGSSIGACSCLPGFFYVNHEMKFQGCYRGFVYEESCGSSNSTLLAYNITMIQHLK
FGGYPFSQVSIVEQDCRKSCLEDCTCWAAQYVNGVCSNFKLPLIYSTLDPSDQSVKAFVK
QSYNISQIAGHTVPYPEKAGNRNKSRKELILIVSLALGSVASLLTVVAICSYIFYRSSDR
QYKKLLENPYLGPNEEFTLRSFSYSELEKATENFKEEIRHGSFGNLYKGILSEGNRTIAV
KRLEKMGDEGEREFKAEMTAIGQARHKNLVHLLGFCLEGSEKILVYEYTSNGSLADILFN
SETSPSWEQRMRLALDISRGILYLHEECETCIIHCNIKANNILVDDLWTAKISDFGLAKF
LVPNQAGNQLQLKTRGYLAPELQNSALISDKVDVYSYGVMLLEIICCRSNMDVNVSTEDE
IFLPTWVHKCFVENDLKKLVGDEEVDVKSLERTVKVGLMGLKVKTCAAFSYSNIMSLYFF
LVLYVIFGSARAQSKPPNTIGLGSSLHPTTQPTEWYSASGHFAFGFYPQGSGYKVGIWLV
GGSNNKDTIVWTAFRDDPEISADSTLAFIDGKVILKTINEEDKTIASSSESAYYANLLDN
GNFVLYNYDDESIYESFSSPGDTILGGQILASGGKLISSFSSANHSSGRFRLVMQGDGNL
VAYPKNLNEAVDAYWASQVYCSGCRNHLLLNSTGILLLINDTDSSVIRRLYSPLMQKNTG
IYRATLDHDGNFRLYSHEFDSNGNSKIRLEWEAIDDLCLVKGFCGLNSFCVTTHKVHSCM
CLPGSYLKENDPSFGDCQRNFTRGKCIHGKEDSSVYKITTTTNLTWEDPPYFATSFLGKE
DCGKSCFEDCDCDAALFDENGQCMKHKLPLRYVKGAPEGSRTAFFKVSNIVVQNPTTDSV
KPPWVVILVLSISFVLYSGAALAFSGFYVFKFRIIKYRKLLQTGTTGLTKDFILRTCSYR
ELKQATDGFKEELGKGAFGAVYKGSFDKGKNLVAVKRLEKVVDEGEREFRAEMKSIGRTR
HRNLVRLLGYCAEGSKRALVYEYMSNGCLANLLFRGATRPDWNLRVNIALDVARGILYLH
EECEAPIIHCDIKPQNILLDELLTAKISDFGLAKLLMPDQTRTFTGVRGTRGYLAPEWQT
NTPISVKVDVYSYGIVLLEIICCRRNIEVYVTKIEEIQLSKWAYSCLVESELDKLVGSEE
VDKNTLERMTAVAIWCIQDEPALRPPMKQVLQMLQGIIDIPIPPCPSSSS
Download sequence
Identical sequences NbS00024295g0007.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]