SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00025934g0008.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00025934g0008.1
Domain Number 1 Region: 265-571
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-77
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Weak hits

Sequence:  NbS00025934g0008.1
Domain Number - Region: 14-68,157-175
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00183
Family alpha-D-mannose-specific plant lectins 0.0064
Further Details:      
 
Domain Number - Region: 65-105,131-163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0157
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00025934g0008.1
Sequence length 591
Comment protein AED:0.13 eAED:0.14 QI:0|0|0|1|1|1|2|0|591
Sequence
MAQMQLPRLEVTGLVTQSSGNPFYSSDFGDLKLRRLKLEDDGNLQVYSFDPVLKQWTVVW
QAIYQLCTIHGTCGTNSICMYDASTTKTSCVCPPGFKKISGESCQRKIPLLSKTKFLPLD
YVNFTGGVDLKVLNFSSCQKQCLDKENCLGFMFKYDGTGYCVLQLDKLLYGFWSPGNEVV
MYLRVDNEEKDVSNFTGMTSLMETSCPVSISLPFPPEESKATTRNIVIISTIFAAELISG
VFFFWAFLKKYIKYRDMARTFGLEVMPAIGPKRFSFSEVKTATNNFIDKIGKGGFGDVYK
GKLNDGRVVAVKCLKNVTGGDAEFWAEVTIIARMHHLNLVRLWGFCAEKGKRILVYEYVP
NGSLDEFLFQKAAQIGSPDRPQRPILDWNIRYRIALGVARAIAYLHEECLEWVLHCDIKP
ENILLGDDFCPKVSDFGLAKLKKKEEVMTISRFRGTPGYIAPEWTKADPITPKADVYSYG
LVLLEIVSGSRNFEHYDSKVDSDQYYFPAWAFDKVFKERNIDDILDPRIKQSYDSRAHFD
MVNRMVKTAMWCIQDRPDARPSMGKVAKMLEGTVEIIEPKKPTIFFLGEEQ
Download sequence
Identical sequences NbS00025934g0008.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]