SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00027684g0006.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00027684g0006.1
Domain Number 1 Region: 488-705
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-49
Family Protein kinases, catalytic subunit 0.00034
Further Details:      
 
Domain Number 2 Region: 215-277
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000017
Family alpha-D-mannose-specific plant lectins 0.012
Further Details:      
 
Domain Number 3 Region: 109-148
Classification Level Classification E-value
Superfamily Lysozyme-like 0.000000172
Family PBP transglycosylase domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00027684g0006.1
Sequence length 777
Comment protein AED:0.25 eAED:0.31 QI:0|0|0|0.88|0.25|0.33|9|0|777
Sequence
CNQTLTANPHLSIGFKKINPLIHFCSIHFPHFFPKISLHNHNSHFQLCFSQRSHTAPDFF
DNTHSFVTKVVILSTFTFALLALRIVSTILVPEFPQRWTRLIAFSKRAELEVMSSCPQHL
IQAVVAYEDRRFFHHFGVDPVGVARVFCRSRLLVVAAQLPNSPVFGFTLTEVVYPNFTAS
NLQFIDSTGSLAMEHSKLLSSIPVLNKLTKNGINITEKDGSFKWSTPSSESAVYAMQLTE
AGILLLLDQFNGTLWESFNHPTDTIVIGQKLPVGMMLSSAMSGDDLSKGHYRLSLTSSDA
ILQWQGLTYWKLSMETKSYTNSNYEVEYMAVNQTGFCAPVDECRVPYVCGRLGICTSDVL
ADNPLCSCPANFNLRSHNSRVINSARLSANSVRRCDARACSFISSVAMRFEMATASEAVW
QCTLLFFCVLPSNSSSASFIRLGFGMDYFTTDFTMPFRYGVNLSICQNLYSVDCSCLGIF
YANTSEDLDAFSIPGLPVRFEYKDLEVATDNFKIQIGTGGFGAVYKGVLPDKTLVADRDF
CTEIAIIGSIHHINLVKLKGFCAQERQRLFVYEYMNRGSLDRTLFGNGPVLEWQERVEIA
LGSARGLAYLHSGCEQNIVHCDVKPENILLHDNFQAKISDFGLSKLLNREQSKMHEQGRH
LELADPKLEGRVSSGDIEKFVRVALCCVHEEPALRPTMVSVIGMLEGEIPPTEPRIESLN
FLRFYGRRFAEASTMEEAGGQIDVMLYPQANTSHTTSRSISNDCFSYISSQQISGPR
Download sequence
Identical sequences NbS00027684g0006.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]