SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00032216g0009.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00032216g0009.1
Domain Number 1 Region: 373-689
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-81
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 937-1197
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.42e-45
Family Protein kinases, catalytic subunit 0.0031
Further Details:      
 
Domain Number 3 Region: 65-175
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.53e-27
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Domain Number 4 Region: 717-827
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.49e-26
Family alpha-D-mannose-specific plant lectins 0.0043
Further Details:      
 
Weak hits

Sequence:  NbS00032216g0009.1
Domain Number - Region: 849-891
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0216
Family Anti-platelet protein 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00032216g0009.1
Sequence length 1209
Comment protein AED:0.24 eAED:0.24 QI:0|0.64|0.53|1|0.92|0.86|15|159|1209
Sequence
MFCSIFLSIILISTALDTITIDKPIRDGDTIVSAGGVYELGIFSPKNSKNRYVGIWYKKI
LPQTVVWVANRNIPLNENSGVLTLKPNGILVLINSSNASIWSSNSSRSLENPEARLLDSG
NLVVRDGNDRDPESNFVWQSFDYPGNTLLPGMKLGRNLVTGLDWYISSWKSTDDPAPGDC
IEGLDSHGYPQFFVWKNSSIVFRTGPWNGIAFSSSPKIKPNVYYTFGFVINQQEIYFKYE
LNEPLPTRIVINQAGTSVNLEECKKMCLADCNCTAYSNLDVRNGGSGCLLWFGELIDIRE
LSHNDQNLFVRVAASELDSDRNQRRKRSVLIAIISAVVAAFILSFVAWFSFRRKNRRTEG
IRGERGAEVGNEDPQLPLFDLVTVTSATKNFSSANVIGEGGFGPVYKGILPNGQEIAVKR
LSKNSGQGLQELKNEIILISKLQHRNLVKFLGCCLEGEERMLIYEFMPNSSLDYFIFDQS
RKASLAWKNRFDIAMGISRGLLYLHQDSRFRIIHRDLKTSNILLDSNLNAKISDFGLAKS
FGGDQMEGKTKRVIGTYGYMSPEYAIDGKYSVKSDVFSIGVIILEIISGRRNRKFLHLEH
HHNLLGHAWLLWNEGKALELMDECLEESFSESQVLRCIQVGLLCVQKLPEDRPTMASIVF
WLENEGLVVPQPKQPGFFIERNSMESTESADEGCLTPGNSKNRYVGIWYKKILPKTVVWV
ANRNIPLNDTSGMLTLKPNGTLVLINSSNASIWSSNSSRSLKNPKAQLLDSGNLVVSGRN
DRNAEIKLVWQSFDYPGNTLLPGMKLGRNLVTGMNWYRSSWKSADDPAPGEYVDFLDSHG
RTSLACGKDDFLKMTGIKMPDSRHSWYNQSVNLEECKKMCLADCNCTAYSNLDVRNGGSG
CLLWFGELIDIRELSHNDQNLFVRVAASELGSEVSNEDMELPLFDLVAVTRATRNFSSGN
VIGEGGFGPVYKGILPTGQEIAVKRLSKYSGQGIQELKNEIVLISKLQHRNLVKLLGCCL
EGEERMLIYEFMPNTSLDYFIFDPSRNASLPWKNRFEIAMGISREYAVDGKYSVKSDVFS
IGVIILEIVCGKRNRRFHHLEHHHNLLGHAWLLWNEGKALELMDECLEESFSESQVLRCI
QVGLLCVQKLAEDRPTMTSVVFWLGNEDMVLPQPKQPGFFVERNSMESTESADEGCLSNT
VSLTVLEPR
Download sequence
Identical sequences NbS00032216g0009.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]