SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00035608g0007.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00035608g0007.1
Domain Number 1 Region: 85-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.07e-19
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Domain Number 2 Region: 347-400
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000706
Family Hairpin loop containing domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00035608g0007.1
Sequence length 511
Comment protein AED:0.06 eAED:0.06 QI:0|0|0|1|0|0|4|0|511
Sequence
MESKNKYFLLFLKLVLLSCFSLEAKLITTNQNSSLGDTLDAEKSIIIGVSMVSSGGIFEI
GSFTLGNLSNYYIGIWYKQITPQTIVWVANRETPLSFSEMGSAKLKIIQDNLLLLNGNQL
SIRTTTINSSTKKPVVAILRDDGNLILKHGSNSLWQSFDHPSHTFLPGSKVGYNKKTKTQ
QTLTSWTNSDDRSPGLFSLEMEPNGESIVRWNKTVHGPWNGHSWGTVPLKSNPMYNFTFI
NNTNEVYFSYYIFIPWVMSRFIIDVTGEIKQLTWLNSTKQWNLFFAQPAQSCDVYGYCGA
YGACNDSSSIALCDCLPGSSGGCARKTSLNCGNASASILEEDKYWMHSHMRLPIDSNIST
AGTATQCESTCLNNCSCTAYSFDDNKCLTWDGDHFNLQQLSANDASGITIFVKLAASEFS
APKGNVMSLVDDSLLESCNEEDALKCINIALLCVQEDVNIRPSMPDVIIMLGSESISILK
PNKPAFTVTTRAYTTTTLCSSELYINSCNES
Download sequence
Identical sequences NbS00035608g0007.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]