SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00038466g0006.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00038466g0006.1
Domain Number 1 Region: 545-832
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-80
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 85-196
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-23
Family alpha-D-mannose-specific plant lectins 0.0034
Further Details:      
 
Weak hits

Sequence:  NbS00038466g0006.1
Domain Number - Region: 369-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00726
Family Hairpin loop containing domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00038466g0006.1
Sequence length 880
Comment protein AED:0.07 eAED:0.13 QI:0|0.66|0.42|1|0.66|0.85|7|0|880
Sequence
MEIKNTMLLLFLQLLLFFCFSVAANTNSTNQNFSLGDTLDAEKSITIGVTMVSSGGIFEM
GFFTLGNRSNYYIGIWYKQITPQTTVWVANRESPISFTEMDTAQLKIIQGNLVLLNGSGL
SIWSTNINDSSTSTKTVVAILRDDGNLVLNNGSKSNSLWQSFDHPSDTFLFGSKLGYNKR
TKTKQGLTSWKNSDDPSPGLFSFEMEPIGELTLKWNKTVRYWTTGPWNGHTWSNSKAPLK
SNPTYNFSYINNTDEVYFTYFIFNPSVLTRFIIDVTGEIKTLTWLNSTKQWNMFLTLPEK
PCDVYGYCGAYGACSDSLNSTPPLCDCLPGFTPKSIKDWNLNKFSGGCVRKTSLKSCANS
SAFTNLEEDKFWMHPQMRLPVDNHTHSFGSASICKSTCLKNCYCTAYIFYGYKCLNWEGD
LFNLQQLSQDDASGMTIYVKLAASEFLIPKGNKYQFLIIYAFALVVADETHKSRRLKVLI
PPTIATSLLLCSFIYLFYRTRRARTKELHISYPFSFYQENPRPSWLNTKEGENNIINEED
EKGIDVPFFSLESILAATDNFSDENKLGRGGFGPVYKGKLQGGREIAIKRLSTESSQGIK
EFKNEVVLIARLQHRNLVKLVGYCIQINEKILLYEYMPNKSLDTFIFDERHHVLLDWKKR
FDIIFGIARGLLYLHHDSRLRIIHRDFKTSNILLDKDLNPKISDFGLARIVQGNVTEANT
NKVVGTYGYMSPEYALDGLFSIKSDVFSFGVVMLEIICNKRNTGFYQRDEALNLLGYAWR
LWNEGNAMSLVDASILESCNEEEALKCINIALLCVQEDASMRPCMPDVSIMLSSKNTSLP
KPNKPAFTARTRACSTSTSSSSKSYINSNNELTVTLEDGR
Download sequence
Identical sequences NbS00038466g0006.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]