SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00039241g0001.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00039241g0001.1
Domain Number 1 Region: 13-60
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000326
Family Protein kinases, catalytic subunit 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00039241g0001.1
Sequence length 75
Comment protein AED:0.46 eAED:0.47 QI:0|0|0|1|1|1|2|0|75
Sequence
MQVIALTSNNLSEYGQDGMIPMSSDVYSFGILMTERFTRMRPSDEIFTGLWRLEYYEVGL
VIPFQVEFVGWWILT
Download sequence
Identical sequences NbS00039241g0001.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]