SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00047436g0006.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00047436g0006.1
Domain Number 1 Region: 517-764
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-57
Family Protein kinases, catalytic subunit 0.00042
Further Details:      
 
Domain Number 2 Region: 81-196
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-19
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  NbS00047436g0006.1
Domain Number - Region: 367-415
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0137
Family Hairpin loop containing domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00047436g0006.1
Sequence length 813
Comment protein AED:0.06 eAED:0.06 QI:88|0.5|0.42|1|0|0.14|7|253|813
Sequence
MPSLFVYLFVLSYISLKTPLPFVTSQKNSVIGDTIDANKWISIASTIVSSGGNFEMGFFT
PGNNSNYYIGIWYKKLSIQTAIWVANRVTPVSIYEMDFAQFKIQNGNLVLFNGTRHIIWS
TSLNFSTNSNTSQVVATLFDDGNLILSNGDINNSRNHIWTSFDHPSHTFMPGSKFGYNKR
TKLKQALISWKNANNPSPGPFTHEVNMDKYSGEGVNMWNDSEIYWKSGPWTGNNFTGVPY
EQNPMFNYTYVNNDNEVYYQYNFFNPALISRFIMDFDGQTKQFLWMDSTNEWNVFYADPK
QVCDVFGYCGAFGICNELSSAASVCDCLPGFKPKSDEDWNLKSFSGGCMRKIGLKCSNFS
VVDGEKDKFLMQKNMRLPANNESMRVQNEVECENTCLKNCDCVAYAYNNGCLIWRGEIFN
LQQLSQDNANGSTIYVRLAASEFSSNKDEHQKQTSKKLKIAIPIGVIAALLFLSCFSYIY
YRKRRSTKIKESTTKSLMQNTEGEAELIDIQDDDKGNIEVPFFSFESILMATDDFSEQNK
LGQGGFGGREIAVKRLSSLSGQGINEFKNEVMLIARLQHRNLVRLLGYCVQSNEKILLYE
YMANKSLDTFKRFEIIEGIARGLLYLHYDSRLRIIHRDLKTSNILLDEELNPKISDFGLA
RVVEGKITQANTNKVSDVFSFGIVILEIISGRRNTGFFHQEETSNLLGHAWRLWKEDKAM
DLVDQSLQELCNKEEAIKCLNIGLLCVQEDPKDRPNTTNIIMMLGSENIISLPRPNQPAF
MTRKCANNTSSSSAAKSDVVSNNELTVTIEIGR
Download sequence
Identical sequences NbS00047436g0006.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]