SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00048013g0001.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00048013g0001.1
Domain Number 1 Region: 428-715
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-79
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 31-166
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.4e-23
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  NbS00048013g0001.1
Domain Number - Region: 311-343
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0863
Family Pan module (APPLE domain) 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00048013g0001.1
Sequence length 771
Comment protein AED:0.17 eAED:0.17 QI:0|-1|0|1|-1|1|1|0|771
Sequence
MTWIDNDGLILVSNNSNFAFGFNPTKDVTLFLLVVIHVSSSTIVWSANRGSPVRNSDNLM
FDETGNAYLQSGGSTIWSTNTAKKGVSVMELRDSGNLVLVGKDGSIVWQSFSHPVDTLLS
GQTFTQGMKLVSSPNNNNLSYSLEFKSGDMVISASFQPPQPYWAMGKDNRRIINQVGGDV
TSAILDGNSWKIYDQKEVLLWQFIFSDNKDANATWVAALGNDGYITFSILQEGSSAASAI
RIPQDECSRPASCDPYFVCYSGNKCQCPSALPSCKLGIDSFCNKAKDPVELVDAGDSLGY
FALGFVSPSAKTDLNGCKASCLGKCSCAAMFFDSSSENCFMFDQIGSLQGSANRAGFDSY
IKVSASQGNGDNGRGGKGRLPIIIGIVISTTFVILGLIYGSICYQRRKNKLPDSAKESSE
EGNFLEGLSGMPIRFSYRELQNATNNFSIKLGQGGFGSVYQGVLADGTRIAVKKLEDVGQ
GKKEFRAEVSIIGSIHHLHLVRLRGYCAEGTHRLLAYEYMSNGSLEKWLFKKSKEFMLDW
DTRFNIAVGTAKGLAYLHEDCDVKIVHCDIKPENVLLDDHFLAKVSDFGLAKLMTREQSH
VFTTMRGTRGYLAPEWITNYAISEKSDVFSYGMVLLEIIGGRKNYDPSESSEKSHFPSYA
FKMMEEGKLKDLIDRNLKVEEEDERVSTAIKVALWCIQDDMSLRPSMAKVVQMLEGICTV
PSPPTAAQMGSRLFSSFLKSLSGDATSSGTSAPSDCNSDAYLSAVRLSGPR
Download sequence
Identical sequences NbS00048013g0001.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]