SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00055687g0009.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00055687g0009.1
Domain Number 1 Region: 142-401
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-73
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 930-1128
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-57
Family Protein kinases, catalytic subunit 0.00045
Further Details:      
 
Domain Number 3 Region: 517-626
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.93e-23
Family alpha-D-mannose-specific plant lectins 0.0052
Further Details:      
 
Weak hits

Sequence:  NbS00055687g0009.1
Domain Number - Region: 11-49
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0377
Family Anti-platelet protein 0.065
Further Details:      
 
Domain Number - Region: 785-828
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0628
Family Anti-platelet protein 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00055687g0009.1
Sequence length 1147
Comment protein AED:0.17 eAED:0.20 QI:0|0.66|0.56|1|0.73|0.62|16|816|1147
Sequence
MRRTPLECGTSDRFLKYSGVKLPDTRHSWFDNTIGLEECQRLCLGNYSFVAYSNLDVKEG
GSGCLLWFNELFDFREYAEIEQDLYVRMAASEIGSDRKTKRAMLIAIISTVSAITILECT
IHLNIFMKFSHFTGGQERKQDMELPLFDLMTITAATNNFSTDNLIGEGGFGPVYRGKLSA
GPEIAVKKLSKHSGQGLEELKNEVVLISKLQHTNLVKLLGCCLEGEERMLVYEYMPNSSL
DHFIFDDSRKGRLPWENRFQIAMGISRGLLYLHQDSRLRIIHRNLKTSNILLDSELKLKI
SDFGLARIFGGDQIEAKTKRVIGTYGYMSPEYAVDGKFSMKSDVFSLGVLLLELVSGRKN
RTFHHSGHHHNLIGHAWLLWYEGKALELMDTSIKPRHLLPKPMIKSWFSYILGIDLQNEV
LVVFQTTYGREDHERQDILTCLIHPTQLDRLSLTVLKKDATKVNGQGDTITTTQFIKDGQ
TIVSAGGTFELGFFSPGETSTNRYVGIWYKKPSVITPVWVANRVAPVTNKSGVLNVIQSG
LVVLVNDTNATAWSTNSSTTVQNPVAQLLDTGNFVVTDADDPNPENFLWQSFDYPSNTLL
AGMKHGTDLGTGLERYLSSWRSNDDPAPGEYTYHCDPTGYPQNLMRKAPNVTFRAGPWNG
LRWSGAPSMVNNWIISFGLIMNSREIYYNYELVNKSVISTPVIKPFGKTMCIIRIEKTQS
WVNYHSADADDCDTYKLCGAYSTCNILSDPFCQCLDKFEPKHPDDWIRSDWSSGCVRKRS
LNCTADGFLKYSGVKLPDTRFSWFNETMTLDECRAVCLRNCSCMGYTNLDIRNGGSGCLL
WIGELVDIRQLSQSGQDIYIRMSASDIDVAGSAGSNGKKAFILAVALPLLVALILLGLGV
GLILYKRRREDPVITTKGRLDGHSNKNDNSNQSHSEDFELPLFDLFTLTKATDNFSFENK
IGEGGFGQVYKRRNLVKLLGCCIQGVEKMLVYEYLPNTSLDLYIFGEERSTILDWPKRFN
IIKGIARGLMYLHQDSRLRIIHRDLKASNVLLDIEMNPKISDFGMARSFGGNETGANTRR
VVGTYGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLDMHGCLI
KKEGNWN
Download sequence
Identical sequences NbS00055687g0009.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]