SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00061054g0004.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00061054g0004.1
Domain Number 1 Region: 74-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.42e-26
Family alpha-D-mannose-specific plant lectins 0.0063
Further Details:      
 
Domain Number 2 Region: 501-589
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000404
Family Protein kinases, catalytic subunit 0.0065
Further Details:      
 
Weak hits

Sequence:  NbS00061054g0004.1
Domain Number - Region: 350-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00255
Family Pan module (APPLE domain) 0.07
Further Details:      
 
Domain Number - Region: 210-305
Classification Level Classification E-value
Superfamily Api92-like 0.0183
Family Api92-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00061054g0004.1
Sequence length 655
Comment protein AED:0.13 eAED:0.13 QI:49|0.25|0.4|1|0.5|0.8|5|278|655
Sequence
MFQKKEFLIILILFIIVLVPFCTSIESISFNQSLKDGDLLISSNKSFALGFFSPGNSNKT
YVGIWYNNIPEQTVVWVANRDNPINSTFGILSINPTGNLEILDKKTKNLVWKTNISSANI
TEKSYSAQLLDTGNFVLFQDLKKEVIVWQSFDYPTNTILPNMNFGNDKKTGLNRSLISWK
SMEDPGSGEYVYKIEINGTIPQVFLYKNSNRIWRTGPWTGLGWSGVPEMKPGYIFTINYV
DNDSEASVTFSMLDSAISRLVLNESGMMNILNWQESTQKWVQFWYAPKDPCDNYVHCGKN
SNCNLYNLAQFECSCLPGYEPSDNRSWYLRDGSHGCLRKKDENICKNGEGFAKVTNVKIP
DTYTAILNKSMGLQECEKLCLNNCSCTAYASANVSVGGIGCITWYGDLIDTREFTDGGQD
FYIRVSASTLAQFLKNSNGYHRKRTISIVTVCISAILIAVSIAYKEDQFTSLITLKRNLA
SYESSSRGNEIDGSEHVDGQLTNGQEIAVKRLSKTSGQGVEEFKNEVTLIAKVQHRNLVR
LLGCCIQKGEKMLVWDFWNDDKAIEVVDPLLGDWYEASEVLRCIQIGLLCVQSYANDRPI
MSEVVFMLCNETKLSNPGQPGFVFRSRNSSSIPYSSSASVGTSVNDISITAQHSR
Download sequence
Identical sequences NbS00061054g0004.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]