SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00002876g0009.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00002876g0009.1
Domain Number 1 Region: 546-811
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-75
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 1004-1051,1087-1328
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.86e-69
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 3 Region: 113-189,224-250
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.23e-27
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 
Domain Number 4 Region: 864-941
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-25
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  NbS00002876g0009.1
Domain Number - Region: 503-544
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000505
Family Protein kinases, catalytic subunit 0.018
Further Details:      
 
Domain Number - Region: 376-420
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0785
Family Hairpin loop containing domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00002876g0009.1
Sequence length 1443
Comment protein AED:0.22 eAED:0.24 QI:0|0.2|0|1|0.4|0.5|6|0|1443
Sequence
MIAKQRQYFAILLFIYLLFRLSQFAISQHSWNTNFSRLNSTAGLSSLWINRPSLLINSTT
DDFYGLTPILLRGIAGPQFLCGFYCNYNATECFLGILLFHNRSDRQNDLINFPQLVWSAN
RNHPVKANATLKLGRDGNLVLSDSDGTFVWSTNTTGKSVSGLNLTERGNLVLFDKRKRAI
WQSFDHPTDSLLPGQSLVRGQKLIASISASNRSQGLLSLTILNGSCTTYTDTDPPQYYYT
LTYSDSPYFSFDGRTLTALQDPPTSTAQCIKLDPDGHLRVYQWAVIDWKEVSDILMPDAR
NCGYPMVCGRYSICTNNGQCTCPPEENFFRPLSDRKPDLGCSQLTEVNCDSSRYHSFVEL
KDTVYFAFKFSHELSSSIFWLEGKKLEECKRACLSNCSCKAAVFENDWDSNRIGSCLLLN
EVFSLIDNEGGRGKTIYLKVQNSSKALNQSPIILEGKKSRPFKVIIGSTLAALFGIILSI
STCFVLFKRRTDKSRKAGYLLDLEPILPGMLTRFSYNDLKTITEDFSKKLGEGGFGSVYE
GTLKDFSKKLGEGGFGTVYEGTLSNGTKIAVKHLDGLGQVKESFLTEVNIVGGIHHVNLV
KLIGFCAEESHRLLIYEYMINGSLDRWISPEKQQNGLTWLTRQKIISDIAKGLAYLHEDC
SQKIIHLDIKPQNILLDQHLNAKISDFGLSKLIEKDKSKVVTRMRGTPGYLAPEWLSSII
TEKVDVYAFGIVLLELLCGERIWIGPKLMKKMSIWLVRKAEEEQLVDMVDKNNEDMQLHK
EEVTEMMSIAAWCLQGDYTKRPSMTVVVKALEGLVSVESNLDYNFTNVPQVGAGNQQREA
TISTKLASVLSGPRSNGEKGIINLPQLVWSANQNHPVKANATLQLGRDGNLVLADFDGTL
VWSTNTTGKSVSGLNLTERGNLVLFDKRKRTIWQSFDHPTDCLLPGQKLVSGRKLTTTIS
STNHSFSFTVLREILALFCSKRGQKSRKAGYLLDLEPILPGILTRFSYNDLKIITEDFSK
KLGKGGFGSVYEGTLSNGTKIAVKHLDALGQVKESSLTEVNIVGGVYEGTLSNGTKIAVK
HLDGLGQVKESFLTEVNIVGGIHHVNLVKLIGFCAEESHRLLIYEYMINGSLDRWISPEK
QQNELTWLTRQKIISDIAKGLAYLHEDCSQKIIHLDIKPQNILLDQHLNAKISDFGLSKL
IEKDKSKVVTRMRGTPGYLAPEWLSSIITEKVDVYAFGIVLLELLCGRKNLDWSQADEED
VHLVSVFRRKAEQEQLMDMVDKNNEDMQLHKEEVTEMMSIAAWCLQGDYTKRPSMTLVVK
ALEGLVSVESNLDYNFTNVPQVGAGNQKREATISTKLASVLSGPRFASSQISWYLNASLL
NSTAGLPTSWINKPSSFANSTFRSSPWTPILLSRTDRTKFHLFAFYCNGAKHRMLSWCPF
CIP
Download sequence
Identical sequences NbS00002876g0009.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]