SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00014914g0019.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00014914g0019.1
Domain Number 1 Region: 216-282
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-19
Family DNA-binding domain from rap30 0.0038
Further Details:      
 
Domain Number 2 Region: 21-151
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.000000217
Family Rap30/74 interaction domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00014914g0019.1
Sequence length 289
Comment protein AED:0.09 eAED:0.14 QI:0|0.6|0.66|1|0.6|0.83|6|76|289
Sequence
MAEKMSGSNLKSAAVHGVTMNSHLEMNKPDRNVWLMKCPTLVSTFFQQHLHSSSAPPLNF
DNDGLSSFVSPAPVAKVVVAVDPLLSNDATQFTMELAGTSSGNMPTLYSMDMSTDFVPMS
IFSDGIGWHFIWKRRLSVEGKIYQKFDMKPHHENSENYGKLCRERTNKYMTKSRQIQVID
NDSAKHMRPMPGFFATKASGSADKKKVPSKGLEMKRTRRDRDEMEEIMFKLFERQPNWTL
KQLVHETDQPEQFMKDMLKLLCIYNNKGAHQGTYELKPEYKRSEDKPDS
Download sequence
Identical sequences NbS00014914g0019.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]