SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00017386g0013.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00017386g0013.1
Domain Number 1 Region: 73-133,167-321
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.26e-17
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 
Domain Number 2 Region: 383-481
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000285
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00017386g0013.1
Sequence length 486
Comment protein AED:0.08 eAED:0.15 QI:0|0.44|0.3|1|0.55|0.6|10|0|486
Sequence
MGARCSNLSFCLWPSNIKSHDLYTSDIEKWAENEQLNLPAFREYGLEELKAATSTFSINN
IVSEHGEKAPNVVFKDEAEAVGQLRSKRLANLLGCCCEGDERLLVAEFMPHETLSKHLFH
CKSCSFRFSGFMLTCQLKQFLCKLVFLSNPTLQYIYLTVVSVGSIDLGDNQPLKWAVRLR
VALYLAQALDYCSSKGRELYHDLNSYRVLFDQDCDPRVIVQTWPSLRWSDPREYGLQLLD
LLCGKHIPPSHALDLIRGKNFLMLMDSCLEGHFSNDDGSELVQLASRRLQHEPHDRPNVK
SLLTSLTSLHKEKDAPSTVLMSIARETTSPSQVPLTPLGEACSRLDLSAIHEILEKAGYK
ENEGIANELSFQMWANQIQETLNSRKSGDSAFRDKIFTTAIKCYTEFLEGGNVKSPTVLA
RRSLCYLMSEKPQEALADAMQALVQFSNWPTAFYLQAAALFTLGMDSDAREALKDGSSLD
FRRMRQ
Download sequence
Identical sequences NbS00017386g0013.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]