SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00018482g0006.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00018482g0006.1
Domain Number 1 Region: 319-605
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-75
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 105-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-24
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  NbS00018482g0006.1
Domain Number - Region: 208-246
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0247
Family Hairpin loop containing domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00018482g0006.1
Sequence length 646
Comment protein AED:0.14 eAED:0.14 QI:79|1|1|1|1|1|2|110|646
Sequence
MYIKLNWFTSQSYNYHPNFFFMAVSWIFPFLFPLFCYFHSVTSILLDSSTASLSTIWINS
LSIPRPILVQESFGPRYACGFYCNGNCETYIFAIFIVSEYDDPIVIWSANRNNPVRINAT
LQLTLGGNLVLRDADGTLVWSTNTTDKSVAGLKLTHLGNLVLFDVNNVTVWQSFDHPTDS
LVPGQKLIPGQKLTASVSATNLTERDIDDTDMTTCKNACLRKCSCKAAIFGYASNSSKGE
CRLLSEIFSLMNNEKDKTRYNSYAFLKVQNETQRKRHVNGAIVGSVTGISMLGIIIGCII
FTFWKKRKEYEVEEHYLDNMPGMPVRFSYDDLKPATENFSKKLGEGGFGSVFGGTLKDDT
KIAVKFLDGIGKAKKSFLAEVETIGSIHHLSLVQLIGFCAEKSHRLLVYEFMSNGSLDIW
IYSGNQEFVLDWKCRKKIINDIAKGLAYLHDECRQKILHLDIKPQNILLDEKNDAKLSDF
GLSKLIDRTQSKVVTTMRGTPGYLAPEWLSAVITEKVDVYSFGVVVLEILYGRKIFKPSE
PKEQRLLMSLLKRKAEEGRIMDLIDKRSEDMQLYKEEVVDTMQVAAWCLQRDYTKRPSMS
TVVMVIEGTVDVEKSLDYNFLVPHTVSDINIMDYAPLLPSILSGPR
Download sequence
Identical sequences NbS00018482g0006.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]