SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00019813g0007.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00019813g0007.1
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000000000136
Family PAPS reductase-like 0.0079
Further Details:      
 
Domain Number 2 Region: 173-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000408
Family Thioltransferase 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00019813g0007.1
Sequence length 246
Comment protein AED:0.04 eAED:0.06 QI:0|0|0.5|1|1|1|2|134|246
Sequence
PLRRALKGLRAWITGQRKDQSPGTRSEIPIVQVDPSFEGLDGGTGSLVKWNPVANVDGKD
IWNFLRAMNVPVNSLHSQGYVSIGCEPCTRAVLPGQHEREGRWWWEDAKAKECGLHKGNI
KDESVNGNGNGAVHANGTTTVADIFDTKAIVNLSRPGVENLLKLENRREPWLAMEGSYVE
LAEKLASYGVKVGKFRADGEQKAFAQQELQLGSFPTILFFHSSQPIKYVSEKRDVDSLLA
FVNALR
Download sequence
Identical sequences NbS00019813g0007.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]