SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00022029g0010.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00022029g0010.1
Domain Number 1 Region: 536-785,816-858
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.36e-68
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 99-188,248-278
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.2e-25
Family alpha-D-mannose-specific plant lectins 0.0058
Further Details:      
 
Weak hits

Sequence:  NbS00022029g0010.1
Domain Number - Region: 210-245
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000101
Family alpha-D-mannose-specific plant lectins 0.022
Further Details:      
 
Domain Number - Region: 421-466
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00369
Family Anti-platelet protein 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00022029g0010.1
Sequence length 1358
Comment protein AED:0.09 eAED:0.10 QI:0|0.37|0.33|1|0.62|0.44|9|0|1358
Sequence
MTPQIVLILLISMAFWVNSIPNASSEIVKSRNHNVNITHVAESIEELFQTGRKLGSSKKS
RKLESLNKSRVVLSGNINILSENSTFELGFFKTNDETKWYLGIWFASVPTPTYVWVANRE
RPIKNPSLATMEITEDGKLVLKEDSRTIVWETSNLDKAKDVKLLDQGNLVLVSSEGNLVW
QSFDFPTDTWLPGMNLTAERCKAFGPRKFGNLVWQSFDFPTDTWLPGMNLTATKWLTSWK
SSTDPSQGRYSLRLQPSSYGEIVLVYNGTYPYWSTGNWSENAFVGVPEMTVPYIYKFNFI
APFTPMASFGYSEVSLENGMAPPLTRFIVDFTGQIKQFTWFPQSWNMFWSQPENLCKTYG
LCGNLGFCNSKSLNPCKCLPGFSPLDSDSWDAGDFSDGCRRESDEVCSEKDGFEEVGMSY
DGARLVSSTGTRSECEKACLGNCSCIGFYHKERTKLCTNLYESLLNLRNLTSDGTIEDKL
YVRVQGGGNTQKKQIQGRLLLIEMICGFVVILSVGIGTFLVLKRRRIRKKNKEEEDIFPI
MNLNVFSYKELNAATKGFSEKLGHGGFGTVFLGEISDSSLVAVKRLERPGGGEKEFRAEV
CTIGNIQHVNLVRLRGFCSENSHRLLVYEYMPKGSLSAYLRRDGQNLSWEVRFRVAVGTA
KGIAYRIHAKGRDGQNLSWEVRFRVAVGTAKGIAYLHEECRSCIIHCDIKPENILLDEDF
SAKVSDFGLAKLLGRDFSRVLATMRGTWGYVAPEWISGLAITTKADVYSYGMTLLELIGG
RRNVEAPPSAKGKEGGTEEKWFFPPWAARQIVEGNIAAVIDERLRGVYDETEAERLGLVA
VWCIQDDESMRPSMGMVIAAVIDERLCGMYDVMEAERVGLVAIWCIQDDESMRPSMGMVV
KMLEGVVEVTMPSPPKLLQALVSGESFHGVGVGSDNGTSRGTSRSGGFSSGYNPQPSIAS
GDSQASTPLYGGSSLEPTELHSAPSAMLADYPPVHGFQDAKNLVCMESGKLWAIAGPIAF
NILCNYGINSFTSIFVGHIGDVELSAVAISLSVIANFSFGFLLGMGSALETLCGQAFGAG
QVELLGVYLQRSWIILVGSCFCITPLYIYSAPILRLLGQRHDIAELAGKFSIQIIPQMFS
LAINFPTQKFLQAQSNVAVLAWVGFMALIVHIGVLFLFVRVFRWGVTGAAAAYDVSAWAI
ALAQVIYIVGWCKDSWKGFSWLALKELWPFVKLSVASAVMICLEIWYFMTIIVLTGHLED
PVIAVGSLSICMNLNGWEGMLFIGINAAISEKMQKAVSKLAYLLAVTMLLNSVQPVISGV
AVGGGWQALVAYINLACYYVIGLPLGFLLGYKTRLGVQ
Download sequence
Identical sequences NbS00022029g0010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]