SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00025065g0006.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00025065g0006.1
Domain Number 1 Region: 112-352
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.63e-29
Family Protein kinases, catalytic subunit 0.0033
Further Details:      
 
Domain Number 2 Region: 418-480
Classification Level Classification E-value
Superfamily TPR-like 0.0000000483
Family Tetratricopeptide repeat (TPR) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00025065g0006.1
Sequence length 519
Comment protein AED:0.35 eAED:0.35 QI:0|0.58|0.61|1|0.75|0.76|13|0|519
Sequence
KKEAFWWGRIGCFAEEVVFPIAAKEKGRFLVGQNWLLCSGSCVSHAAKVEKRKLFGWAEL
VSLQRKFVFRFAAKANISVMGCECSKFASCCWTGQSGPIHEAQNPDEEKDEVSDLPAFRE
FTFEQLRIATSAFAVENIVSEHGEKALNVVYKGKLENQRLVAVKRFNRSAWPDSRQFLVR
DTQPMKWAMRLRVALYIAQALEYCTGKGRALYHDLNAYRILFDEDGDPRLSCFGLMKNSR
DGKSYSTNLAFTPPEYLRTGRITPESVIFSFGTLLLDLLSGKHIPPSHALDLIKDRNLEM
LTDSCLEGQFSTDDGTELVRIASRCLQYEPRERPNLKSLVAALYPLQKEAEVPSHVLMGI
TRDGETMSLSPLGEACLRTNLTSIHEILDTLGYKDDEGAATELSFQMWTDQMLETLNSKK
KGDAAFKNKDFRAAIECYTKFIEVGTMVSPTVYAHRSLSYLMSDMPQEALNDAVQAQQKS
GDVVDLSPTCMQCLVNCVIAIENSFVIIQCHWFLKIQDL
Download sequence
Identical sequences NbS00025065g0006.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]