SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00030233g0002.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00030233g0002.1
Domain Number 1 Region: 304-405
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.74e-18
Family Protein kinases, catalytic subunit 0.0025
Further Details:      
 
Domain Number 2 Region: 66-116
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000017
Family alpha-D-mannose-specific plant lectins 0.018
Further Details:      
 
Weak hits

Sequence:  NbS00030233g0002.1
Domain Number - Region: 175-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0136
Family EGF-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00030233g0002.1
Sequence length 458
Comment protein AED:0.18 eAED:0.18 QI:0|0|0|0.75|1|1|4|0|458
Sequence
MGNHLLGFLLFLTTPLVASAQATNSSSNRNITLGSSIVASVNSLAWQSPSGDFAFGFHQI
EGQKLYLLAIWFDKIPNKTLVWYANGDKLAPEGSKLELKTDGELILDNPDGKVLWRPILP
CMLLIFLGDCNKFETESYLIDWAPRNGKWEGSWFRVWSKPDDICSSIQGQYGLGTCGFNS
YCMLNSNGRPNCNCLPGFNFSGPSNEFKGLEKKGTCYKKKMPVSNGRREEVDGKGFVKVL
ISSIPSGDFPYSPSQRGNGKKDKSAFSILGSVLLGTSAFFNFAILASLIALYVYRRRPRC
VGSSSIPETNLRHFTFQELKVATNGFKLELGRGAFGTVYKGELSSSNSRIVVAVKKLDKL
ANDGKNEFETEASVIARTHHKNLVRLVGFCDEGPENKLLVYEFESRLLGRPPFRSVKARM
EQKNQNCVWGCKRNLVFARGVQHTDHTLRYTASKHPAG
Download sequence
Identical sequences NbS00030233g0002.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]