SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00032198g0015.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00032198g0015.1
Domain Number 1 Region: 544-842
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-72
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 65-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-28
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Domain Number 3 Region: 263-303
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000902
Family Anti-platelet protein 0.083
Further Details:      
 
Weak hits

Sequence:  NbS00032198g0015.1
Domain Number - Region: 390-437
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000177
Family Anti-platelet protein 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00032198g0015.1
Sequence length 853
Comment protein AED:0.06 eAED:0.06 QI:0|0|0|1|0|0|3|0|853
Sequence
MKSLKLCSLFPFLILSLLIFSFPLTTSRILFRGNSFSVKDGSNFITSPQNTFTCGFFPIG
NTNAYYFGIWFTNSRDKTVVWNAKQERPVNKQGSKLTLRKNGALVLTDVDDTIVWETNTT
SFDIEKAELLETGNLVLKNPQGNILWQSFDLPTDTLLPHQFFTKNHRLVPPLRKGGLSPG
YFSLYFDSDNVLRMIYDGPQVSSIYWPNPDRDVYWNGRTSQNSSRFAYFDNMGSFFSSDR
LQFNVSDMGREHVKFVEIPNVDYWGFDLNFTSSMSLESCRTLCLDDPRCRAFVYRRNGEG
TCFTKGMLFNGYRSPGFPGTAFFKVPKNLSGSESGFLNLESTEAKCGPSPEDILFGTPSM
YELDFKKVKWIYLYLFSFTLGGIEILFKEFVEIPNVDYSGFDLNFTNSMSLDSCRILCLD
DPRCRAFVYRRNGEGTCFTKVMLFNGYRSPGFPGTAFFKVPKNLSGSESGLLNLESTDAK
CGRSPENVLFGTPSMYELDFKKVKWIYLYLFSFILGGIEILFIVLGWWALFSKHGIPASI
EEGYKMVSSTQFRRFTYTELKKATKNFKVELGRGGSGAVYKGVLADGRLVAIKRLANEFQ
EEFWAEMTTIGRINHMNLVRMWGFCSEGRHQLLVYEYVENSSLDRHLFKLDILGWKQRFS
VALGTAKGLAYLHHECLEWVIHCDVKPENILLDSELEPKIADFGLAKLSQRGGAGSDFTK
IRGTKGYMAPEWALNQPITAKVDVYAFGIVILEIVKGSRLSSWVVDDDEFDHEHESQLRK
FVRIVKRKIQSGEDSWVDKIVDQRLEGNFNKKQAVTLIEIGLSCVEQDRNKRPKMASVVQ
TLLECEDETTILT
Download sequence
Identical sequences NbS00032198g0015.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]