SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00033933g0001.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00033933g0001.1
Domain Number 1 Region: 461-767
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-75
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 71-159,228-247
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000262
Family alpha-D-mannose-specific plant lectins 0.0077
Further Details:      
 
Weak hits

Sequence:  NbS00033933g0001.1
Domain Number - Region: 192-264,353-370
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000656
Family alpha-D-mannose-specific plant lectins 0.0085
Further Details:      
 
Domain Number - Region: 326-359
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0549
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00033933g0001.1
Sequence length 787
Comment protein AED:0.02 eAED:0.04 QI:0|-1|0|1|-1|1|1|0|787
Sequence
MSCPSPPFSLLFLLLFLLNHPLFSSAQKSTKILTIFNSTLSPWTPKQNQILLSPNSTFAA
GFLPSNSTNSYVFSIWYYELPNKTIVWSASPNSPVNSSASLSISTSGELKLSPQARVSSA
PNLWPKSNLLVKNTSALLFLQESGNLVYGKWGSFLNPTDTYLPNQNINGTNATSSNEKFQ
FLGSSTLFYNGNDSYFAFQGSLLLLEVTGLVTQSSGNPFYSSDFGDPKLRRLKLEDDGNL
QIYSFDPILKQWTVVWQAIYQLCTIHGTCGTNSICMYDASTTKTSCICPPGFKKISGESC
ERKIPLLRKTKFLPLDYVNFTGGLDLKVLNFSSCQKQCLDKENCLGFMFKYDGTGYCVLQ
LDKLLYGFWSPGNEVVMYLRVDIEEKDVSNFTGMTSLMETSCPVSISLPFPPEESKATTR
NIVITSTIFAAELISGVFFFWAFLKKYIKYRDMARTFGLEVMPAIGPKRFSFSEIKTATN
NFIDKIGKGGFGDVYKGKLNDGRVVAVKCLKNVTGGDAEFWAEVTIIARMHHLNLVRLWG
FCAEKGKRKLVYEHVPNGSLDEFLFQKAARIRSPDRPQKPILDWNIRYRIALGVARAIAY
LHEECLEWVLHCDIKPENILLGDDFCPKVSDFGLAKLKKKEEVMTISRFRGTPGYVAPEW
TKADPITPKADVYSFGLVLLEIVSGSRNFEHYDSKVDSDQYYFPAWAFDKVFKERNIDDI
LDPRIKQSYDSRAHFDMVNRMVKTAMWCIQDRPDARPSMGKVAKMLEGTVEIIEPKKPTI
FFLGEEQ
Download sequence
Identical sequences NbS00033933g0001.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]