SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00034594g0010.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00034594g0010.1
Domain Number 1 Region: 497-785
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-79
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 77-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.93e-27
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  NbS00034594g0010.1
Domain Number - Region: 350-418
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00549
Family Anti-platelet protein 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00034594g0010.1
Sequence length 831
Comment protein AED:0.11 eAED:0.11 QI:0|1|0.85|1|1|1|7|0|831
Sequence
MKATSNEGFKLFFLLCLFSICQILGATDSITTTKILKDGELNISSSGGSFEMGFFSPGNS
KFRYFGIWYKNISVTTVVWVANREAPLSNTSGTVKVIKPGVIVIVNETNHIIWSTNTSRS
VQNPIAKLLNSGNLVVKDADVDDDKVGSFLWQSFDYPTDTLLPGMKIGFNFVTGKEIYLS
SWKNEEDPAPGDYTYHCDPSGYPQNILKKGSNVIYRSGPWNGLRFSGAINSRESQFYTFG
VFSTKTEVYFSYQLFASVVTRFILNQNGALQRWTWGDRNKGWALYLSLPTDNCDTYRLCG
GYGSCNSLNSPVCGCLDKFVPRIPEDWNKADWSSGCVRSTELNCLKGDVFLKYSKLKLPD
TRNSWFNASMNLEECKRICLKNCSCMAYSNLDIRNGGSGCLLWFEDLLDVRQLAKEGQDI
YIRMAASELASQDKSNGHKGKLLAWIIPLSAGVVLIFLSMVIFLRRRKRASEKKTGFWGC
SGNYKMDCHNGNQSEEFELPLFDLSTIAKSTNNFSEESKIGEGGYGPVYKGVLEQGQEIA
VKRLSKTSTQGQDEFKNEVMYIVKLQHRNLVKILGCCIEGEEKMLIYEYMPNGSLDSFIF
DDTESRALDWPKRFHIINGIARGLMYLHQDSQLRIIHRDLKANNILLDSDMNPKISDFGI
ARSCEDDKFGAKTHRVVGTYGYLSPEYAVHGVYSVKSDVFSYGVLVLEIVSGKGNRRFSH
PDHNLNLLGHAWKLFKEGRSMELLGDFPIDVHSTPEVIRSIHVGLLCVQHCPEDRPSMSS
VVMMLNNEGELPPPKQPGFYVEANAPDNEFSSSQYAHSTGNEITITVLDAR
Download sequence
Identical sequences NbS00034594g0010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]