SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00048796g0002.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00048796g0002.1
Domain Number 1 Region: 503-727
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-72
Family Protein kinases, catalytic subunit 0.000095
Further Details:      
 
Domain Number 2 Region: 117-241
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-26
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Domain Number 3 Region: 741-838
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000137
Family Protein kinases, catalytic subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NbS00048796g0002.1
Sequence length 877
Comment protein AED:0.07 eAED:0.07 QI:0|-1|0|1|-1|1|1|0|877
Sequence
MALASLKHVLRLLIIVLLKNLTLAQFPDYHMAKIPTTWINNNVSVANVTKPLTYPYYSFN
HSSGPFMRILMLKEIEKDMAYACGFASNGEDDSFVFSVGVVRLRQDFVGIRHWSDLELVW
FANRNQPVHENGTLQLLQDGDLVLKDADGTLVWSTSTANKFVWGIKMMETGNLVLHDMYN
QTVWQSFDHPTDTLLQGQKLRAGQRLVARVSSSNWTEGNYYLSVSNQGLFAFYISNKPQM
YFKFLVTGERNSFNESYVKAVNGTLAFYISSTEPTAVFSRPSRMNFLRYDYDGHLRSYAE
GSDQQTDILADFIGVCDYPTACGSLELCSNGFCSCPGPFKQSTDRQNKGCVEVSPVECSG
KRSHKMMRVLDVYYFNYVDIEAAALRGTDVESCQELCMSNCSCKVVLFRYFTNFSRGDCF
LPSPVLTLINDGKKRSGYESSAFIKIPNDIEKDTDSLAARRVGIIAGSTSGAFLLIAICV
SILITFNRKQTLQENNDDYSDEISGTLRFSYEQLKVATRNFQQKLGQGGFGSVYEGILQD
GQKVAVKVLDGFGQGKREFLAEVQTIGSIHHVNLVRLIGVCAEKDHKLLVYDFMSNGSLD
KWIFGTGSTQFTFNWKIRKSIIHDIAKGLAYLHEECRQRIVHLDVKPQNILLDDNFCAKV
SDFGLAKLVDKDQSRIVTRIRGTPGYLAPEWFSAFFTEKADVYSFGVVAMEILCGRKNVD
YSHSLEYPHLLSLFMKKAENNITEKVDVYSFGVVVMEILCGRKNVDYSHSLEYPHLLSLF
MKKAENNQLIDMIGNYNDDLQCNTSEVVHIMKLAVWCLQSDFTLRPSMSMVVKVIEGTMD
IESHLDYSVPNSQTIAAIKRVADTTTTLFPSILSGPR
Download sequence
Identical sequences NbS00048796g0002.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]