SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00049539g0002.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00049539g0002.1
Domain Number 1 Region: 532-786
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.2e-76
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 60-155,208-238
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.26e-23
Family alpha-D-mannose-specific plant lectins 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00049539g0002.1
Sequence length 832
Comment protein AED:0.18 eAED:0.18 QI:0|0.66|0.57|1|1|1|7|0|832
Sequence
MKIFPFLLLLFFCSSVFNQKVNGQGDTITTTQFIKDGETIISSDGAFELGFFSPGDSSAN
RYVGIWYKKISVITPVWIANRVAPVTNKSGVLKVIQSGLVVLVNDTNATVWSTNSSTTVQ
NPVAQLLDTGNFVVRDAGDPNPENFLWQSFDYPTDTLIASMKLGKDLVTGFERYLSSWLA
SMKLGKDLVTGFERYLSSWRSNDDPAPGEYTYHCDPTGYPQDLMRKGPNVIYRAGPWNGL
RWSGAPNMVNNSITSFGLIMNSREIYYKYELVNKSVINTLVIKPNGNTMRMIWIEKTQGW
VNYHSADADDCDTYKLCGAYGTCNILSDPVCQCLDKFEPKHPYDWNRADWSSGCIRKRSL
NCTGDGFLIYSGVKLPDTRNSWFNEAMTLDECRAVCLRNCSCMGYTNLDIRNGGSGCLLW
IGELVDIRQLSQSGQDIYIRMSASDIGSAGSKEKKAVILAVALPLLVALVLLGLGVGLIL
YKRKRREDPVLTTKNNISLVFLLKRGLNKVYLYHKMAGRIGGHINKNDDSNQSHHEDFEL
PLFDLLTLTKATDNFSLENKIGEGGFGQVYKGVLESGQEIAVKRLSETSKQGLNEFKNEV
NCIAKLQHRNLVKLLGCCIQAEEKMLVYEYLPYKSLDLYIFDEERSALLDWPKRFNIING
IARGLMYLHQDSRLRIIHRDLKASNVLLDIEMIPKISDFGMARSFGGDETGANTRRVVGT
YGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHNPEDRPSMS
SVIMMLSNEGILPPPKHPGFFTERNVNDAEFSWSTQTPSSINEVTITLLNAR
Download sequence
Identical sequences NbS00049539g0002.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]