SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00056580g0001.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00056580g0001.1
Domain Number 1 Region: 83-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.18e-26
Family alpha-D-mannose-specific plant lectins 0.0081
Further Details:      
 
Weak hits

Sequence:  NbS00056580g0001.1
Domain Number - Region: 353-415
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00129
Family Anti-platelet protein 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NbS00056580g0001.1
Sequence length 446
Comment protein AED:0.26 eAED:0.27 QI:0|-1|0|1|-1|1|1|0|446
Sequence
MRNINTNGSYFHQFSLFLLISQFLLPILAIPTDTITPTQPLTKDQTLISSDQLFELGFFS
PGGVNSDKWYVGIWYKEPQDRTFVWVANRANPLSNSPNSVLKLTENGTLLLVDGQTRNSV
WSSDQTPATNVVAQLLDSGNFVVRPQNDETEQSYTWQSFDYPTDTLLPGMKLGWDSKSGL
NRNITSWKTATDPAPGDFTFKINTNGLPEIFLTNKQEIVYRSGAWNGLRFSGVPEMKPTE
IITFEFQFKSDEIYYMFELHNKRLYSRLLVNHNGRLERYTWIPTNSIWSRFWYAPKDQCD
DYTECGISGICDTNLSPVCKCMVGFKPKNQVAWDLRDGSDGCVRFHKLDCETDSFNILRN
MKLPDTTSSFVDKNMNLDECEAMCRKNCSCTAYTNSNISGTGSGCVIWSTELIDMRQYAA
AEGGQLLYIRVASSDAGMIPFFCELF
Download sequence
Identical sequences NbS00056580g0001.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]