SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NbS00057692g0005.1 from Nicotiana benthamiana 0.4.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NbS00057692g0005.1
Domain Number 1 Region: 457-754
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.23e-75
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 93-218
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.64e-20
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Weak hits

Sequence:  NbS00057692g0005.1
Domain Number - Region: 346-382
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0216
Family Anti-platelet protein 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NbS00057692g0005.1
Sequence length 1198
Comment protein AED:0.11 eAED:0.12 QI:0|0.28|0.25|1|0.71|0.62|8|0|1198
Sequence
MMPQIVLSLLISMAFWVSSIPNASSEIAKSRNHNVTMTHVAKSTEEFFPTGRELGSLKGS
RKLESLNKSRVILSGNITILSENESWDLRKRAEIPTPTYVWVANRERPIKNPSLATMEIT
EDGKLVVKEDSRTIVWETSNLDKAKDVKLLDQGNLVLVSSEDTWLPGMNLTAAKWLTSWK
SSTDPSQGRYSLRLQPSSYGEIVLVYNGTYPYWSTGNWSENAFVGVPEMTVPYIYKFNFI
APFTPMASFGYSEVSLENGMPPPLTRFIVDFTGQIKQFTWFQQAQSWNMFWSQPENLCKT
YGFNPLDNYSWDAGDFSGGCRRESDEVCNKKDGFEEVGMVSYDGARVVSSTGTRSECEKE
CLGNYSCIGLYHNDRTKLCKNLYGSLLNLRNLTSDGTMEDKLYVRVQGGGNTQKKQIQGR
LLLIEMICGFVVILSVGTGTFLVLKRRRIRKKNKEEEDVFPIMNLKVFSYKELNAATTGF
SEKLGHGGFGTVFLGELPDSSLVAVKRLERPGGGEKEFRAEVCTVGNIQHVNLVRLRGFC
SENSHRLLVYEYMPKGSLSAYLRRDGQNLSWEVRFRVAVGTAKGIAYLHEECRSCIIHCD
IKPENILLDEDFSAKVSDFGLAKLLGRDFSRVLATMRGTWGYVAPEWISGLAITTKADVY
SYGMTLLELIGGRRNVEAPPSATGEEGGTEEKWFFPPWAAQQIVEGKIAAVIDERLCGMY
DVMEAERVGLVAIWCIQDDESMRPSMGMVVKMLEGVVEVTMPSPPKLLQALVSGESFHGV
VVGSDNGTSRGTLRSGGFSSGGSAGETPLYGGSSMEPTELHSAPSAMLADYPPVHGFQDA
KNLICMESGKLWAIAVPIAFNILCNYGINSFTSIFVGHIGDVELSAVAISLSVIANFSFG
FLVRPSTIARSLLTKIMDNPCWLPLYIFSAPILKLLGQRHDIAELAGKFSIQIIPQMFSL
AINFPIQKFLQAQSNVAVLAWVGFMALIVHIGVLFLFVRVFRWGVTGAAAAYDVPAWAIA
LAQVIYIVGWCKDSWKGLSWLALKELWPFVKLSVASAVMICLEIWYFMTIFVLNGHLEDP
VIAVGSLSICMNLNGWEGMLFTGINAAISVRVSNELGSGRPRAAKYSVFVTVAESLIIGI
FCMILIILTKDHFALLFTSSEKMQKAVSKIAYLLAVTMLLNSVQPVISGTKICCFLLN
Download sequence
Identical sequences NbS00057692g0005.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]