SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000028 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000028
Domain Number 1 Region: 1281-1488
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.93e-45
Family Laminin G-like module 0.00028
Further Details:      
 
Domain Number 2 Region: 1767-1973
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-39
Family Laminin G-like module 0.000000352
Further Details:      
 
Domain Number 3 Region: 2-94
Classification Level Classification E-value
Superfamily TIMP-like 3.06e-38
Family The laminin-binding domain of agrin 0.00000508
Further Details:      
 
Domain Number 4 Region: 1539-1742
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.09e-33
Family Laminin G-like module 0.0006
Further Details:      
 
Domain Number 5 Region: 398-465
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 2.22e-17
Family Ovomucoid domain III-like 0.0065
Further Details:      
 
Domain Number 6 Region: 481-530
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000693
Family Ovomucoid domain III-like 0.0049
Further Details:      
 
Domain Number 7 Region: 1077-1155
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000772
Family SEA domain 0.0031
Further Details:      
 
Domain Number 8 Region: 106-176
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000984
Family Ovomucoid domain III-like 0.0043
Further Details:      
 
Domain Number 9 Region: 831-900
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000116
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Domain Number 10 Region: 629-680
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000915
Family Ovomucoid domain III-like 0.004
Further Details:      
 
Domain Number 11 Region: 546-595
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000025
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 12 Region: 723-766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000232
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 13 Region: 275-323
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000263
Family Ovomucoid domain III-like 0.0098
Further Details:      
 
Domain Number 14 Region: 182-251
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000319
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 15 Region: 777-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000028
Domain Number - Region: 1481-1516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000114
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 337-372
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00018
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000028   Gene: ENSNLEG00000000023   Transcript: ENSNLET00000000031
Sequence length 1975
Comment pep:known_by_projection supercontig:Nleu1.0:GL397470.1:360658:398846:1 gene:ENSNLEG00000000023 transcript:ENSNLET00000000031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVRVWRYLKGKDLVARESLLDGGNKVVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWP
AHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHFTPVPPTPADACRGMLCGFGAVCEPN
AEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRD
PCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRLACARQ
ENVFKNFDGPCGSLRGAFPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDDGVTYEN
DCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCQFNAVCLSRRGRPRCSCDRVICDGAYR
PVCAQDGRTYDSXXXXXXXXXXXAHAPVSSPDQAPSPCLGVQCAFGATCAVKNGQAACEC
LQVCSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCLFGALCEAET
GRCVCPSECVALAQPVCGSDGHTYPSECMLQVHACTRQISLHVASAGPCETCGGAVCAFG
AVCLAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACQQQTQIEEARAGPCEQAECG
SGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECE
LKKARCESQQELYIAAQGACRGPTFTPLPPVAPSHCAQTPYGCCQDNITAARGVGLAGCP
SACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCD
PQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRVLGPAGCEADASAPATCAETRCEFGA
LCVEESGAAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQ
EAVAPSTHPTSASVTLSTPGLLLSQALPAPPGALPLAPSSTAHSQATPPPSSLPRTTASI
PRTTVWPVLTVPPTAPSPAPSLVASAFGESGSTDGSGDEELSGDQEASGGGSGGLEPFEG
SSVATPGPPMERASCYNSALGCCSDGKTPSLDAEGSNCPATKVFQGVLELEGVEGQELFY
TPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFRSIRLRDLGPGKSVRAIVDVHFDP
TTAFRAPDVARALLWQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFFTGATSGAIAAVAT
ARATTASHLPSSAGTPRALHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPGRRPPAPQQPP
KPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAICEKVLGAPVPAFEGRSFLAFPTLRA
YHTLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVRVE
PGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVVLEQT
FVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCRGGAPCQALEAG
RFHCQCPPSRVGPTCADEKSPCQPNPCHGAAPCHVLPEGGAQCECPLGRGGTLCQTASGQ
DGSGPFLADFNGFSHLELRGLHXXXXDPREKMALEVVFLARGPSGLLLYNGQKTDGKGDF
VSLALQDRRLEFRYDLGKGAAVIRSKEPVTLGAWTRVSLERNGRKGALRVGDGPRVLGES
PVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFNGAIQLVSLGGRQLLTPEHVLRQVDV
TSFADHPCTRASGHPCLNGASCVPREAAYVCLCAGGFSGPRCEKGLVEKSAGDVDALAFD
GRTFVEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQL
SYNLGSQPVVLRSTVPVNTNRWLRVVAHREQREGSLQVGNEAPVTGSSPLGATQLDTDGA
LWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRRPLHLLEDAVTKPELQPCPTP
Download sequence
Identical sequences ENSNLEP00000000027 ENSNLEP00000000028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]